[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for lsal0:ABE00528.1


[Show Plain Result]

## Summary of Sequence Search
   1::463
 186::369  PF03796 0.0% 59.5628415300546  DnaB-like helicase C terminal domain 
  11::112  PF00772 0.0% 50  DnaB-like helicase N terminal domain 
 188::368  PF06745 0.0% 25.7861635220126 PF06745 KaiC 
 208::362  PF00004 0.0% 27.1844660194175  ATPase family associated with various cellular acti 
   1::463


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MNNDIMTDNLPPQNIEAEQAVLGAIFLNTDALADAMEYVEPDDFYRRAHQILFQAMVDLNNDGEAIDVLT
PF03796         ----------------------------------------------------------------------
PF00772         ----------ppqsieaEqavLgalLldpeaidevadilkpedFyepahrliFeailelyekgepiDlvt
PF06745         ----------------------------------------------------------------------
PF00004         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           VQNYLTTNNQLDDVGGVAYIAELATSVPTAANAGYYAKIVEEKSMLRRLISTATNIITQANNGDDDVPSL
PF03796         ----------------------------------------------------------------------
PF00772         vaeelekkgkleevggaayLaelvasvpsaanieayaeivke----------------------------
PF06745         ----------------------------------------------------------------------
PF00004         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           LDSAERQIMDVSERRNRSGFREIKDVLNETLSDIDRLSQQSEDITGLPTGYREFDKMTAGLQPDNLIILA
PF03796         ---------------------------------------------glstgfkdldeltsglqksdLiiia
PF00772         ----------------------------------------------------------------------
PF06745         -----------------------------------------------ktgIeglDellkgGipegrvvli
PF00004         -------------------------------------------------------------------lly


                         -         -         -         +         -         -         -:280
query           ARPAVGKTAFALNIAQNVATSTDTSVAIFSLEMSAESLVNRMLCAEGSINANHLRTGQLDEGEWQNLIVA
PF03796         aRPsmGKtalalniaenvakkekkkvlifSlEMsaeqlaerllasesevsseklrsgelseedferlaea
PF00772         ----------------------------------------------------------------------
PF06745         tGepGtGKtifalqFlikgaeeygepgvfvtveesaedlrenak....slgwd......lekleeegkla
PF00004         GppGtGKTllakavakel......g..vefleisgsellsk.............................


                         -         *         -         -         -         -         +:350
query           MGALSNTSIFIDDTPGIKMAEIRAKCRRLAKEKGNLGLVVIDYLQLIEGSNKESRQQEVSEISRQLKKLA
PF03796         akelselklyiddtpelslaelrakarrlkkekk.lgliviDYLqLieaskkksenrqqevseisrsLka
PF00772         ----------------------------------------------------------------------
PF06745         iidasesaeeea.......eedleelieklaeaikeika.krvviDsitgl....yeekeavaReilrql
PF00004         .............yvgesekkirelfke.akekap.svlfiDEidalaksrgseseeeervvnqLlteld


                         -         -         -         -         *         -         -:420
query           KELSVPILALSQLSRGVEQRQDKRPVLSDIRESGSIEQDADIVAFLYRDDYYERGESKSEEDGDDQDSLN
PF03796         LAkeLnvpvvalsQLsRav---------------------------------------------------
PF00772         ----------------------------------------------------------------------
PF06745         vrvlkklgvTailvseks----------------------------------------------------
PF00004         glkkkeskvlvi----------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           QDVGEVELIIEKNRAGARGTVKLLFIKSYNKFSNISYAQEPPM---------------------------
PF03796         ----------------------------------------------------------------------
PF00772         ----------------------------------------------------------------------
PF06745         ----------------------------------------------------------------------
PF00004         ----------------------------------------------------------------------