[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for lsal0:ABD98844.1


[Show Plain Result]

## Summary of Sequence Search
   1::288
  33::144  0.00031 17.0% 0043518 00435181 1/2   drug resistance efflux transporter EmrE 
 186::284   0.0054 20.0% 0043518 00435182 2/2   drug resistance efflux transporter EmrE 
   1::288


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MNIIIALIPAVCWGIFPLIASKTGGGPANQILGTGLGATLVGLIVFAIMHPTITASAFIWAFMAGACWTI
00435181   1/2  --------------------------------lrlllaallllpfalllklspgrtwllllllgllltal
00435182   2/2  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           GQIGQFISMKPERMGVTTTMPISAGFQLVGNSLIGMLFLGNWSGTTAKIIGLVALAIVVVGVILTAVTDD
00435181   1/2  aflllflalkr..lpaglayalllylgpvfaallgwlll....gErlsllqllGialilaGvlllllggr
00435182   2/2  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           NKSESASVKDVLFLLVTTIGYWIYSSFPNLPAVRHVSPTALYLPEMLGILCGALIFVFATRETSALTARE
00435181   1/2  rrke------------------------------------------------------------------
00435182   2/2  ---------------------------------------------lrlllaallllpfalllklspgrtw


                         -         -         -         +         -         -         -:280
query           SWAGMIGGAIWGIAAFAYIFSAQENGTSSAFIYTQLSVVISTLGGMLFLHERKTSRELGFTLAGLVLLVV
00435181   1/2  ----------------------------------------------------------------------
00435182   2/2  llllllgllltalaflllflalkrlpaglayalllylgpvfaallgwlllgErlsll....qllGialil


                         -         *         -         -         -         -         +:350
query           GSVITGFI--------------------------------------------------------------
00435181   1/2  ----------------------------------------------------------------------
00435182   2/2  aGvl------------------------------------------------------------------