[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for lsal0:ABD98850.1


[Show Plain Result]

## Summary of Sequence Search
   1::380
   1::379 1.9e-123 39.3% 0046206 00462061 1/1   ependent transferases                   
   1::377 6.3e-116 42.4% 0052302 00523021 1/1   ependent transferases                   
   1::379 3.5e-112 41.5% 0038034 00380341 1/1   ependent transferases                   
   1::381 9.2e-103 37.6% 0041260 00412601 1/1   ependent transferases                   
   1::379 2.6e-101 37.7% 0036780 00367801 1/1   ependent transferases                   
   1::379  2.2e-96 35.7% 0051195 00511951 1/1   ependent transferases                   
  42::379  3.6e-94 38.2% 0047340 00473401 1/1   ependent transferases                   
   1::379  2.9e-81 31.2% 0048952 00489521 1/1   ependent transferases                   
  54::380  5.2e-80 37.9% 0048747 00487471 1/1   ependent transferases                   
   2::380  1.1e-77 29.1% 0046165 00461651 1/1   ependent transferases                   
   1::382  2.5e-76 33.7% 0051757 00517571 1/1   ependent transferases                   
   1::379  1.5e-69 32.8% 0040526 00405261 1/1   ependent transferases                   
  41::380  2.7e-66 31.4% 0042144 00421441 1/1   ependent transferases                   
   5::377    2e-63 31.7% 0040897 00408971 1/1   ependent transferases                   
  44::379  4.4e-63 29.5% 0045909 00459091 1/1   ependent transferases                   
   1::380  8.6e-63 31.7% 0040134 00401341 1/1   ependent transferases                   
  33::379    1e-62 30.7% 0048074 00480741 1/1   ependent transferases                   
  49::379  1.2e-60 32.9% 0045973 00459731 1/1   ependent transferases                   
  46::379  1.3e-60 32.2% 0052731 00527311 1/1   ependent transferases                   
  17::379  1.5e-59 25.2% 0049524 00495241 1/1   ependent transferases                   
  44::378  1.7e-59 27.7% 0039341 00393411 1/1   ependent transferases                   
  16::382  1.8e-57 28.6% 0049070 00490701 1/1   ependent transferases                   
  43::376  6.1e-55 29.8% 0050753 00507531 1/1   ependent transferases                   
  38::382  6.2e-53 28.0% 0036406 00364061 1/1   ependent transferases                   
  10::379  2.5e-52 29.9% 0044083 00440831 1/1   ependent transferases                   
  38::380  1.5e-48 29.5% 0046007 00460071 1/1   ependent transferases                   
  44::376  1.2e-47 27.3% 0035589 00355891 1/1   ependent transferases                   
  44::378  1.7e-47 26.5% 0041674 00416741 1/1   ependent transferases                   
  44::378    1e-45 22.9% 0050390 00503901 1/1   ependent transferases                   
   3::380  3.9e-45 24.3% 0046056 00460561 1/1   ependent transferases                   
  44::377  9.4e-45 26.1% 0044807 00448071 1/1   ependent transferases                   
  41::379    4e-44 23.9% 0051323 00513231 1/1   ependent transferases                   
  50::379  1.5e-43 27.7% 0049754 00497541 1/1   ependent transferases                   
  33::380  4.6e-42 26.8% 0047441 00474411 1/1   ependent transferases                   
  22::380    2e-41 27.4% 0050261 00502611 1/1   ependent transferases                   
  44::376  3.4e-41 23.1% 0044595 00445951 1/1   ependent transferases                   
  43::376  3.6e-40 25.5% 0052070 00520701 1/1   ependent transferases                   
  42::379  4.1e-39 27.2% 0050754 00507541 1/1   ependent transferases                   
  43::377  5.8e-38 25.2% 0050157 00501571 1/1   ependent transferases                   
  16::379  6.5e-38 24.6% 0046584 00465841 1/1   ependent transferases                   
  46::380  2.6e-37 29.5% 0046087 00460871 1/1   ependent transferases                   
  48::377  5.3e-37 25.6% 0041704 00417041 1/1   ependent transferases                   
  16::379  6.6e-37 23.3% 0046547 00465471 1/1   ependent transferases                   
  44::378  5.2e-36 23.2% 0038952 00389521 1/1   ependent transferases                   
  44::379  1.4e-34 21.7% 0042383 00423831 1/1   ependent transferases                   
   4::380  1.9e-34 27.3% 0035586 00355861 1/1   ependent transferases                   
  40::379  5.5e-33 26.1% 0049486 00494861 1/1   ependent transferases                   
  44::377  4.3e-31 24.2% 0037569 00375691 1/1   ependent transferases                   
  15::265  9.9e-30 26.5% 0053335 00533351 1/1   ependent transferases                   
  42::380  2.6e-29 23.9% 0047095 00470951 1/1   ependent transferases                   
  44::380  8.7e-29 24.4% 0046747 00467471 1/1   ependent transferases                   
  44::379  1.4e-27 23.8% 0046024 00460241 1/1   ependent transferases                   
  44::265  6.9e-27 20.8% 0052862 00528621 1/1   ependent transferases                   
  43::376    1e-25 23.6% 0047956 00479561 1/1   ependent transferases                   
  44::380  9.3e-25 23.5% 0052164 00521641 1/1   ependent transferases                   
  45::376  2.4e-24 23.5% 0050076 00500761 1/1   ependent transferases                   
  44::332  1.2e-23 23.9% 0035246 00352461 1/1   ependent transferases                   
  44::379  1.5e-21 22.9% 0046965 00469651 1/1   ependent transferases                   
  38::378  5.2e-21 24.7% 0046154 00461541 1/1   ependent transferases                   
  50::379  5.6e-20 26.2% 0048571 00485711 1/1   ependent transferases                   
  42::380  1.2e-19 25.7% 0035700 00357001 1/1   ependent transferases                   
  44::379  1.1e-18 24.2% 0045392 00453921 1/1   ependent transferases                   
  42::379  5.7e-17 24.0% 0047670 00476701 1/1   ependent transferases                   
  44::298  8.5e-17 21.5% 0035401 00354011 1/1   ependent transferases                   
  21::378  1.1e-15 20.8% 0050696 00506961 1/1   ependent transferases                   
  52::265  5.9e-13 21.6% 0045171 00451711 1/1   ependent transferases                   
  46::232    7e-12 24.6% 0035846 00358461 1/1   ependent transferases                   
  44::376  9.8e-12 17.4% 0044523 00445231 1/1   ependent transferases                   
  47::379  6.4e-09 19.4% 0051993 00519931 1/1   ependent transferases                   
  69::265  3.6e-08 19.8% 0046089 00460891 1/1   ependent transferases                   
  43::379  6.4e-08 21.3% 0050340 00503401 1/1   ependent transferases                   
  47::355  7.3e-08 20.5% 0042809 00428091 1/1   ependent transferases                   
  69::265  1.1e-07 21.6% 0050768 00507681 1/1   ependent transferases                   
  66::358  1.3e-07 20.4% 0042806 00428061 1/1   ependent transferases                   
  49::355  2.3e-07 22.7% 0052943 00529431 1/1   ependent transferases                   
  50::265  2.7e-07 21.8% 0046255 00462551 1/1   ependent transferases                   
  22::170  4.9e-07 22.1% 0052157 00521571 1/1   ependent transferases                   
  49::288  7.8e-07 22.6% 0047581 00475811 1/1   ependent transferases                   
  63::198  3.6e-06 24.2% 0035073 00350731 1/1   ependent transferases                   
  47::298  2.6e-05 21.0% 0050977 00509771 1/1   ependent transferases                   
  66::198  0.00024 21.7% 0045639 00456391 1/1   ependent transferases                   
  54::219  0.00044 24.8% 0051723 00517231 1/1   ependent transferases                   
  66::198  0.00058 23.3% 0045068 00450681 1/1   ependent transferases                   
   1::380


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MKFETKLIHGGQSEDQATGAVSISVYRSSTFHQYELGGNPKWEYSRTGNPTRAALEALIADLEGGVAGFA
00462061   1/1  rqvggivlilsenappfyvpeavldalteayaegfagyrggygysrlrnptaealeralaalegaeevvl
00523021   1/1  mkfetlllhagldpdpltgavnppiylsstpvfdtpeeiaaafealesgyiysriggptveeleealael
00380341   1/1  llalgtdvihlgsgepdylgpvappiylsstftfevleaviealagggtgydysrgpnptvealeealae
00412601   1/1  ealellalgtdvihlgsnenp.lgavappiyqtptfvldalaealdggrygrgpnpgleeleealaellg
00367801   1/1  kdlsletlaihagsgpdv.lnlvgppiyltnefvfelpeavlealaegltgytysrggnplrealeekla
00511951   1/1  llkrllkldtlairagfpllartggvivldlsagtppfpvpeavlealaealaggrygyggnpgveelee
00473401   1/1  -----------------------------------------ealgkdliylgsgapglgtppvvraaaea
00489521   1/1  mdlsklldrletlalhagllpdvllatgadviplgqgepdvppaveealallgagatgygysrgtgplre
00487471   1/1  -----------------------------------------------------deleealaellgaeeal
00461651   1/1  -kldtllvhagrlldlgtggidliilstgeppfpvpeavlealaealasghlygygpgpgveelrealae
00517571   1/1  elirketlrlrgginasenvlslnvlgaqtspevieaaeealggygysrggdplreeleellaelfgaea
00405261   1/1  mslttlrvaelakrlanlvpsgilrvladelkaegkdiiklsagepdfgppdeiteaaaealdqgstfle
00421441   1/1  ----------------------------------------kgviyldsaattpvppevlealaealesll
00408971   1/1  ----iplplgepdfpeevleaviealdsg............g.ytr..gpgvaeleealaellgaehava
00459091   1/1  -------------------------------------------ksdliPdfptipeeeieavaealdsgi
00401341   1/1  miplgsetrklldlisndylglaeiyllyasetpvppevlealleallnkygegnpgsryyggtlyvdpl
00480741   1/1  --------------------------------iyldnagptplppavlealleglghrsgygytelleel
00459731   1/1  ------------------------------------------------dkllsellelllaagllrldpe
00527311   1/1  ---------------------------------------------kkiplgspvfdeeeiaavlealdsg
00495241   1/1  ----------------lldlldirllfpalslfalgkdliyldnaattplppevleamleallellgnph
00393411   1/1  -------------------------------------------lgygpspglpelrealaellgarygva
00490701   1/1  ---------------lllelalaldelellealrklfpllkgliyLdnasttpvppavleamlealeely
00507531   1/1  ------------------------------------------elsqgalelleelqerlaellgadaanv
00364061   1/1  -------------------------------------gypgsrlyqgtlsvdpleeeleerlaelfgaea
00440831   1/1  ---------lgslpepevgaqgepieliageeyldalvgaglinlghghpdvvidLlsdtltgpvltaql
00460071   1/1  -------------------------------------gsggsrllygtnplheeleealaellgaeaall
00355891   1/1  -------------------------------------------lgygpppglpelrealaellgarygva
00416741   1/1  -------------------------------------------llrygdptglpelreaiaellgrrrgv
00503901   1/1  -------------------------------------------mllserldrlgpsvidellelaggpdv
00460561   1/1  --lelellRelfplldlnllldgliyldnaattplppavleamaealeeyygnphsgghelgrgalelle
00448071   1/1  -------------------------------------------lsygategleelrealaellgadpaye
00513231   1/1  ----------------------------------------klllskrldrlgpspirallllaagpdvid
00497541   1/1  -------------------------------------------------nmllserldrlppsailelle
00474411   1/1  --------------------------------iyldgpgptplppevlealarallshrsyeftagleel
00502611   1/1  ---------------------lsslplsllldlnlslssrlplvpldlirelladadgpdvidlgsgepd
00445951   1/1  -------------------------------------------lelssrldglpaslirellelaggpdv
00520701   1/1  ------------------------------------------rlsygttelleeleealaellgaeevll
00507541   1/1  -----------------------------------------helsqgaleleeelaerlaellgadaaiv
00501571   1/1  ------------------------------------------leellelleslllsllyrlplvivraeg
00465841   1/1  ---------------efpllkgliyLdnaalgllppavleamaealeelagngssghrlsrgatelveel
00460871   1/1  ---------------------------------------------lklllepfrikvvepidptiaeeie
00417041   1/1  -----------------------------------------------Pevlealaevlesgwlygtgpgv
00465471   1/1  ---------------dliyldnaaptplppevleamaealeklygnpssghelgygatelleelrealae
00389521   1/1  -------------------------------------------dsaglpelreaiaeylarrygglvgvd
00423831   1/1  -------------------------------------------ldpdvspgtaeleeevvsmlarllgap
00355861   1/1  ---kvylfsaGPa......plppevleaaakellnyqgngasvleishrskeftaileearallrellga
00494861   1/1  ---------------------------------------liyldsdattppppavlealaealevgdgny
00375691   1/1  -------------------------------------------llrypdpglpelreaiaellgvdpeei
00533351   1/1  --------------lfkrlgrlppspirgllalladldgkdvidlgvgiyldpepdlppppavlealaea
00470951   1/1  -----------------------------------------llllllfpllllfpllkgliyLdnagptp
00467471   1/1  -------------------------------------------lllllllllllldeelllllaeelyrl
00460241   1/1  -------------------------------------------llgYpdpqGlpelreaiaellgrrygv
00528621   1/1  -------------------------------------------ladrlknlppsitlallalalellagg
00479561   1/1  ------------------------------------------gllrypdpglpelreaiaall....gvd
00521641   1/1  -------------------------------------------lrllfpirelfpllmdliyldnagptp
00500761   1/1  --------------------------------------------gtehidflsdnptgphpavlealaea
00352461   1/1  -------------------------------------------rkfiaeplriksaegvyltdvdgreyl
00469651   1/1  -------------------------------------------llskrlerlppspilellellaggpdv
00461541   1/1  -------------------------------------lselllllleglyevdpeiaeliekelkrqgev
00485711   1/1  -------------------------------------------------elheeleellad.tgrekilv
00357001   1/1  -----------------------------------------kefteileearellaellgapddyevvll
00453921   1/1  -------------------------------------------ssggttelaealaellaellpldrvff
00476701   1/1  -----------------------------------------yelspgateleeevadwlaellglpvafl
00354011   1/1  -------------------------------------------llgYpdpaGlpelreaiaellarrygl
00506961   1/1  --------------------pgsgtfvsdrlpdlppspirellelaggpdvidlgigepdlgppplpavi
00451711   1/1  ---------------------------------------------------reaiaellarygvgvdpee
00358461   1/1  ---------------------------------------------ygpsggileleealaelfgaddaif
00445231   1/1  -------------------------------------------llellaaellaggpdvidlsvgepdfp
00519931   1/1  ----------------------------------------------kpliyLdgpgptplpprvleamar
00460891   1/1  --------------------------------------------------------------------lv
00503401   1/1  ------------------------------------------elshrskefteileearellrellnapd
00428091   1/1  ----------------------------------------------gltelavelaerlaellplgldrv
00507681   1/1  --------------------------------------------------------------------lv
00428061   1/1  -----------------------------------------------------------------vaivv
00529431   1/1  ------------------------------------------------tepavelaelLaellpglekvf
00462551   1/1  -------------------------------------------------vidlsvgepdfppppavleal
00521571   1/1  ---------------------PlvivraegayltdvdGneylDflsglgvlnlGhahpevvealkeqldk
00475811   1/1  ------------------------------------------------dptvneleerlaellgkeaavf
00350731   1/1  --------------------------------------------------------------periatvv
00509771   1/1  ----------------------------------------------smdlserlsrlpsyireilelaae
00456391   1/1  -----------------------------------------------------------------vqtls
00517231   1/1  -----------------------------------------------------alelfgadyllwganvq
00450681   1/1  -----------------------------------------------------------------vaivv


                         -         -         *         -         -         -         -:140
query           FASGSAAIHATFSMYSAHDHFIVGSDVYGGTFRLINKVLKRFGLEFTVVDIQDLAAVENAIQDNTVAIYF
00462061   1/1  tssgtaAialallallkpGDevlvsdplyggtltllrllgarggivvtfvdgldlealeaaitektklif
00523021   1/1  lgaeealltssgtaAlllallallkpGDevivpaptygstaeairlllkrlGakpvfvdldedlealeaa
00380341   1/1  llgaeaalvtssgtaAillallallgpGDevlvpdplygstielfglalrlaGaevvfvdlddlealeaa
00412601   1/1  aeevlltsggtaaifallallgpGdevlvpaplygsylalarlalkrlGaevvfvd.ldledleaaitek
00367801   1/1  elegaeealvtssgtaAieaallallkpGdevlvpeplygstlellralakllGaevvfvdlddledlea
00511951   1/1  alaellgaeealvtsggtaaillallallkpGDevlvpapaygsylallrlllkrfGaevvfvdlddlea
00473401   1/1  aadlfanplsggeysrganptleeleealaellgaeealltsggtaailaalallkpGdevivsdpaygs
00489521   1/1  aleerlaellgaeevlltsggteAlelallallkpGdevlvpdptypstlaaarllakvvgvpvdedggl
00487471   1/1  vtssgteAlelallallkpGDevivpsptygatleairllakpvfvdvdedggndlealeaaitpktkai
00461651   1/1  llgaeevlltsggtealelallallkpGdevlvpdptypsyl....aaarll.aevvfvpldedggldle
00517571   1/1  alvtssgtaAillallallkpgdeilvsrglyhgslihg...lklsgakvvfvd..dledlekaikektk
00405261   1/1  esleeaaelfallvsgwlrlsyiygyypnpglpeLreaiaallggvyglavdpenivvtaGatealslal
00421441   1/1  lfgnphslghelsrgatplleelrellaellgadpaeivftsggtealelallalrayglkpgdevlvss
00408971   1/1  tnsgtaAlllallalglgpGDeVivpaltfvstanav....llaGakpvfvdvdpdtfnidpealeaait
00459091   1/1  lsytlgpgvkelEeaiaellgakyalavssGtaAlllallalglgpgdeVivpsptfvatan....aill
00401341   1/1  veeleerlaelfgaeaalvftnsGtaAnlaallallkpgdevlvpslahgstlaaarlagakrlgievvf
00480741   1/1  rellaellgadedaeevlltsggtealeaallallkpgdevlvsdpahgstl..yakaakllGaevvfvp
00459731   1/1  ifsalrkelkrgkdlinliasnnylppavleallealtnkygegypgsrlylgteavgplveeleerlae
00527311   1/1  vytlgptvdelEealaallgakyavavssGtaAlllallallglgpdgkeVivpsltfvatanailla..
00495241   1/1  ssgyslsrganplveelrerlakllgaddpeeivftsggtealnlallalalaglkpGdevivsapehps
00393411   1/1  vdpeeivvtnggtealllallallgpGdevlvpdptypaylaalr....laGaevvfvpldpdggflldp
00490701   1/1  angpsghelgrgalelveelrerlaellgadpaeivftssgtaalnaallalgaallsplkpgdevlvsa
00507531   1/1  vltdggtaaleaallalrltpgdevlvpdgahpsnlaalqtlaallGaevvvvplddlealeaaldedta
00364061   1/1  ailltnsGtaAnlaallallkpgdevlvddlahgstlagarlanasglGaevvfvpvdedglidledlea
00440831   1/1  aellpgdryyggnpgvdeLeerlaellgaehavftnsGteAnllalkallkpgdevivpdlayggtteag
00460071   1/1  fnsGteAnlaalkallgpgdivivdeltHgstl....dglrlsgakvvfvphndlealeaalaeatprtk
00355891   1/1  vdpeeivvtnggtealelalrallgpGdevivpsptypgylaaarll....Gaevvfvpldpdgtfgldl
00416741   1/1  avdpeevvvtnggtealelalrallgpGdevlvpsptypgylaaar....laGaevvfvpldedngfgld
00503901   1/1  idlgigepdlppppevlealaealdsgalllrypdpaglpelreaiaellgrrygvdvdpeeeilvtnGg
00460561   1/1  elrerlaellgadspdevvftsggtealnlallalaaahlkpgdevlvsalehpsnlaalrllaerlGae
00448071   1/1  vvftsggtealeaallallkpgdevlvsapghpsvl..laeaaerlGaevvvvpvdedglldlealeaal
00513231   1/1  lgigepdfppppavlealaealdeggalllgYpdpaGlpelreaiaeylarrygvgvdpeeeilvtnGat
00497541   1/1  ladgpdvidlgsgepdlppppavlealaealdngllgyppsqglpelrealaellaellgadldpetevl
00474411   1/1  realaellgadpdvvlltgggtealeaallallgpgdkvlvpapgyfsvr..laelaerlgaevvvvpvd
00502611   1/1  lglgpppavlealaealaelgpgllgygppeglpelrealaellaelfgaeaadpeeivltnggteAlel
00445951   1/1  idlgvgepdlpppeavlealaealggllgypdppglpelreaiaallgvdpeeivvtsGatealnlalra
00520701   1/1  tssGteAneaallalralgpgdevlvdelahhsildgarll....gaevvvvphndldaleaalteagpp
00507541   1/1  ftsggteAnllallaarryhrargelgpgdevlvpdpaHgsnlaaarll....Gaevvevpvdedgridl
00501571   1/1  ayltdvdgrryldlssglpvnplGhsppevlealaealdrlgngssygptpgveelrealaellgadpae
00465841   1/1  reklaellgadpeeviftssgtealnlalkalrlgpgdeilvsalehpsvleaarllaerlgaevvfvpl
00460871   1/1  kelkraggnlfllasenvyidlvsdaltgsplpamyaalevgddyygggptvdeleervaelfgaehavf
00417041   1/1  eeleealaellgaeeavftssgteAlnlallalglgpgdevivpspthvatlaailll....Gakpvfvd
00465471   1/1  llgadpdeiiftsggtealnlallalrrallkpgdeilvsspehpsvlkaaell.erlgaevvevpvded
00389521   1/1  peeilvtnGatealelllralldpGdevlvpdptYpgylaaarla...tgaevvpvpldeeggflldlea
00423831   1/1  adnleealGaftsGgteanllallaarnralpkrkaaglgipgpeilvs.paHys....vlkaarllgie
00355861   1/1  pedyevlflsGggtaafeaallnllgpgdkvlvlvtghfsvr..aaelakrlglevvlvldaeagglvdl
00494861   1/1  gsdpgleelrealaellgaeaaeivftsgGteAnllallalldpgdevlvsepahpsvleag..aaellG
00375691   1/1  lvtnGatealalllrallnpgdelvlvpdptYpgylaaar....lagaevvpvpldedfgldlealeaal
00533351   1/1  lddgagllgypdpaGlpelrealaellarlfgvevdpeeiaalltnggtealelalralrklgpgdeviv
00470951   1/1  lppevleamlealihhlgpeftelveearellaellgadpgeevvftgggtealeaallgllkpgdkvlv
00467471   1/1  plvivrgegarlldvdgreyidlasnnylglghhpavleaaiealdkygvgspgsrllygttplhdelee
00460241   1/1  dvdpallkledeivvtnGgtealllalralldpGdevlvpdptYpgylaaae....laGaevvpvpldee
00528621   1/1  kdvidlsvgepdfppppavlealaealdgllgypppaglpelreaiaeylerrygvgvdpenilvtnGat
00479561   1/1  peeilvtnGatealalllral.pgdevlvptptYpgylaaar....lagaevvpvpldndfgldldalea
00521641   1/1  lppevleamlealishrspeftelveearellaellgadpyeeivftgggtealeaallnllkpgdkvlv
00500761   1/1  llgddlgygadplveeleeklaellgaeaavlftsgGteAnllallaarepgdevivsataHisvleaga
00352461   1/1  dalsgynvlllghgdpeiDlltDsgtsaasdaqlaallvgddayggdplafeleealaelfgldavlftn
00469651   1/1  idlgvgepdlppppavlealaealdsgllgygppaglpelreaiaeyllrrrgvgvdpeteilvtnGate
00461541   1/1  llliasenylspavlealgsaltnkyaegypgsryyggteyvdpleeeleerlaelfgaehallfanvqp
00485711   1/1  fsggyhgntlallaltgpgdevlvpdplypgylha...allagarvvfvpldvdedghldlealeaalee
00357001   1/1  tgggtaaleaallnllgpgdkvlvlvtghfgn.raa.dlakrlgaevvvvpvdegglldleeleaalidp
00453921   1/1  tnsGseAnelalklarayylakgrlgtggdkilvfeggYHGrtlgalsltgspsylggfgplgagvvvvp
00476701   1/1  llgadpaggvftsGgteAnllallaardralprrkaeglaalgleglpglvilvsdpaHys....vekaa
00354011   1/1  lvgvdpeeilvtnGatealelalralldpGdevlvpdptYpgylaaarla...tgaevvpvpldeeggfl
00506961   1/1  ealaealdsggalllgygdpaglpelreaiaeylgrrrgvdvdpeqilvtnGatealelalrallgpGde
00451711   1/1  vvvtnGgtealalalrllallnpgdevlvpdptypgylaaa....rlagaevvpvpldeengfgldleal
00358461   1/1  vtnGtseanlavilallgpGDevlvdrps...HksilnggarlaGakpvylptdrngfggiggirfkhld
00445231   1/1  pppavlealaealddgvlgyypdpglpelreaiaellgrryvdpeeilvtnGatealalllral.gdevl
00519931   1/1  ylihhrspeftelleearellaellgakndlkyteiiftgsgtealeaalanlllllkpgdkvlvsangh
00460891   1/1  tnGatealflllrallnpGdevlvptPtYpgylaaar....lagakvvevpldeegglflldlealeaai
00503401   1/1  dyevlflsGggtgafeaallnllgpgdkvlvlvtghfsn.raa.deakrlgaevvvldaddgglldleel
00428091   1/1  fftnsGseAneaalklarayalakgtprdkilvfegaYHGrtlgalsltgsklyhaslfgpllpgvvgvp
00507681   1/1  tnGatealalllralldpGdevlvpsptYpgylaaar....lagakvvpvpldgfgldlealeaalkeak
00428061   1/1  tnGgtealalalrllallnpgdevlvpdptypnylai....arlaGaevvevpldeendfgldldaleaa
00529431   1/1  ftnsGseAneaalklaraytgrdkiisfeggYHGrtlgalsltgsgayrlgfaplpgvprlpapdtyrvp
00462551   1/1  aeald.gllgyypsaglpelreaiaeylkrrygvgvdpdnilvtnGasealflllralldpgdevlvpsP
00521571   1/1  lghvsgttelavelaekLaellpglekvfftnsGseAneaalklaraytgrdkiisfeggYhGrtlgals
00475811   1/1  vpsGtmanllalaallqpgdevlcdelaHilldeagaleflsgaklvplp...gedgkldpedleaaird
00350731   1/1  tnGgtealslaaeflkrflrallnpgdevlvpdptypnylaiarl....agaenvvevplddentfgldl
00509771   1/1  lgadgkdvidlgvgepdlldfppppavlealaealddgllgYpdpaGlpelreaiaellkrrrgvgvdpe
00456391   1/1  ttGatealalllrallnpgdevlipdptypnylaa....aklagakvvpvpldeengfgldlealeaale
00517231   1/1  phSgsqAnlavllallkpgdtilglslahGGhlthgslidgvrlsasgkglevvpygvdpetglidydel
00450681   1/1  tnGatealllaarflallnpgdevlvpdptypnylaiakl....agaevvpvplddengfgldleallaa


                         +         -         -         -         -         *         -:210
query           ETPTNPLLQIADIAAITKIAKKHKLKTIVDNTFATPYNQRPLELGADIVVHSATKYLGGHSDVVAGLAVT
00462061   1/1  lespsNptgtvldlaaiaelAhevgallvvDntyaapllldpldlgadvvvhsttKklgghggvrgGylv
00523021   1/1  itpktkaiilehpsnptGtvadleaiaelakkhgilvivDeaqatggllydglelgadivvfSfsKylgg
00380341   1/1  itprtklvvlespsnptgtvadleaiaelahkhgalvivDeayatgvlgdplalgadivvgslsKalggp
00412601   1/1  tklvflespnNptgtvldleeiaelakkhllnpgalvvvDeayatpvlgdplelgadivvhSlsKalgga
00367801   1/1  aitpktklvllespsnptgtvldleeiaelahenhgalvivDeayaagvlldplelgadivvgslsKylg
00511951   1/1  leaaitpktklvvlespsnptgtvldleaiaelahehgallivDeayaagvlgdplelgadivvgslsKa
00473401   1/1  tlallrllleraGaevvfvdlddlealeaaitprtklvllespsnptGtvldleeiaelahehgalvivD
00489521   1/1  dlealeaaietpktkavilespnnptGvvldleeiaelakehgallivDeayaggalgdplelgadivvg
00487471   1/1  ilehpsnptGtvldleeaiaelakkhgillivDeayalgvlgdplelgadivvfSfsKalgGptGlrgGa
00461651   1/1  aleaaitpktklvvlenpnnptGvvldleeiaelakelghgallivDeayalgvlgdplelgadivvgsl
00517571   1/1  lvvl..psnptgrilsledlkeiaeiakeygallivDeahgaglvggpllpsplelgaDivvgSlhKtlg
00405261   1/1  lalldnltnlllkpgdevvvpdptYpgylrlak....llgakvvfvdl.dlealekaitpktklvflesP
00421441   1/1  lehgsvlraae.llerlGaevvlvpvdpdgrldlealeaaidpntklvvlehpnnptGvvlpleeiaela
00408971   1/1  prtkaiv...pvnptGavadleaiaelarehgllvivDaahalgalyggrhpgslgadivsfsasKtltg
00459091   1/1  agakpvfvdvdpdtfnidpedleaaitpktkaii...pvnptGnvadldaiaeiakkhgllvieDaayal
00401341   1/1  vdvdpetglidlddleaairprtklivleh.snptGrvadleeiaelaheygallivDeAhaagllalgl
00480741   1/1  ldedglidlealeaaitegpktklvvlehpsnptGvvldleeiaelakehgallivDaayaagalpldpl
00459731   1/1  lfgaeadelgvavftssGtaAlllallallkpgdevlvpslahggstlaa...arllGagvnfsgllfkv
00527311   1/1  ..gakpvfvdvdpdtnidpedleaaitpktkaii...pvnllGqvadldeiaeiakkhglllieDaaqal
00495241   1/1  tlaawrllaerlGaevvfvdvdedglidlealeaaitpkTklvalvhpsnptGvvlpleeiaelahehga
00393411   1/1  ealeaaitpktklvllvnpnNptGtvldleelealaelarehgllvivDeayaelaydgrpapsllsldp
00490701   1/1  lehgsvlaalallaerlGaevvfvdvidlealeaaltpdtklvllthvsnptGvlldieaiaalahehGa
00507531   1/1  avllehp.nptGvvldlaalaelahaaGallivDaaqaalgllvdpgalgadivvgslhKllgPhglggp
00364061   1/1  alkektklivles.snptGvvadlkeiaelaheygallivDeahaagllgldgrppgelgaDivtgslhK
00440831   1/1  ....llagakpvfvdvdedgnldlealekaitevgaektkaiileppanptGvlplspadlkaireiadk
00460071   1/1  avvvesvfsptGdiaplaeiaelarkhgallivDeahaggvlgrtgrgllellglgadivvgtlsKalGg
00355891   1/1  ealeaaitprtkaiilenpnNPtGtvldleelealaelarehglllivDeayaglvydgklpgslaeldg
00416741   1/1  lealeaaitpktkavilenpnNPtGvvldleelealaelakkhglllivDeayaglvydgkplsalalld
00503901   1/1  tealelalralldpGdevlvpdptYpgylaaar....laGakpvfvpldedgllplllglendflldlea
00460561   1/1  vvvvpvdpdglldlealeaaldprtklvalthvsnvtGvilplaeiaalahehgalvlvDaaqaagalpl
00448071   1/1  eehrtklvilehvnnptGvvlpleeiaelarehgallivDeaqalgalpgdldalgvdivvfslhKalgg
00513231   1/1  ealalllralldpGdevlvpsptYpgylaalr....lagakvvpvpldelltggllseggflldlealea
00497541   1/1  ltsggtealelalrallgpgdevlvpdptypgylaaarll....Gaevvfvpldedgflldlealeaalt
00474411   1/1  pgglvdpeale...tpdtklvllthpenptGvvldlaaiaalarehgpdallvvDaaqslgalpldldel
00502611   1/1  alrallgpGdevlvpdptyhgylaaarll....Gaevvfvpldedgldlealeaalteagadgllpktka
00445951   1/1  llgpGdevlvpsptypaylaalrll....GakvvfvpldleedgflldlealeaaitprtkaillvnpnN
00520701   1/1  rtklvvlesvnnptGtiaplkeiaeladeygallivDeahaggvlgrtgrglaehlgvepdadivvgtlh
00507541   1/1  ealeaaidertaavvltnpnnptGviepleeiaelahehgallivDeayagglglgvdpgdlgaDivtls
00501571   1/1  vlftnggteAlelalkaarllgpgdevlvpepayHgstlaalrlagakvvevtfvpldpdglllpypdle
00465841   1/1  deevdglldlealeaaltpktklvvlehvsnetGvilplkeiaelakehnGdlsallivDaaqavgalgl
00460871   1/1  thsGtaAnllallallkpGdevivpdhflahggfletgga.allsgatpvfvdydlvdpdtgnidlekle
00417041   1/1  vdetgnidlealeaaieehtpktkaii...vvnptGvvadleeiaeiakehgillieDaaqalgalyggl
00465471   1/1  grldlealeaaldedtklvvlthpnnptGvilpleeiaelakehgpdallivDaaqaagvlpldldelgv
00389521   1/1  leealtealkegpktkalllpnpnNPtGtvlsleelealaelarkhgillivDeayaelvfdgppfpsla
00423831   1/1  vrlvpvdendgrmdlealeaaidentalvvatagttptGaiddieeiaelaeeygletglgiwlhvDaAy
00355861   1/1  eeleealidpdtklvalthnetstGvllpieeia....ehgallvvD..aassigsrpidvsgvdvvvas
00494861   1/1  akvvpvp.dedgkldledleaaitedtahgllpklvvltnpnnptGtvyslepleeiaalakehglllhv
00375691   1/1  .pktklvvlpnpnNPtGtvlsleeleelaela.khgalvivDeayaelvyggpllslldllgrvivlgsl
00533351   1/1  psptypgylaaa....rlaGakvvfvpldedgtfgidlealeaaiteapktkaiilepnpnnPtGvvlpl
00470951   1/1  ssnghfsvl..laeiaerlGaevvvvpvdegglvdlealeealkepktklvalthvenstGvinpleeia
00467471   1/1  rlaellgaeaalvfnsGteAnlaalrallgpgdivl...vdelnHgstldglrlsgaevvfvphnDldal
00460241   1/1  ggflldldaleaaitpktklivlpnpnNPtGtvlsreeleelaelarehgillivDeayaelvydgepkd
00528621   1/1  ealflalrallnpGDevlvpdptYpgylaaarl....agakvvpvpldedgflldlealeaaitpktkli
00479561   1/1  aiktpktkllllcnpnNPtGavlsreelealaelarehgillivDeayadlvydgasfvslaslldnviv
00521641   1/1  ssnghfsvl..aaeaaerlGaevvvvpvdpgglvdlealeaaleepdtklvalthvetstGvllpleeia
00500761   1/1  ilglggakvvlvpvdedgkldleaLeaairedtahvhgtrpvlveitgntetGtvysldeleeiaelcre
00352461   1/1  sGteAnelalkallayhrakgepgdtviisngyhgttlehv....slagakvvrvpfdpaldealllped
00469651   1/1  alalalrallgpGdevlvpsptypayaaaar....laGakvvfvpldeeggflldlealeaaitpktkai
00461541   1/1  ssGtaAnlaallal.lkpgdevltpslehgGhlthgstfdatalalsglgaepvfydvdpetglidpdal
00485711   1/1  ldaggdrtaavilepvqnptGvvlppeeylkelrelarkhgillivDeayagfgrtgkpfalellgvddr
00357001   1/1  dtklvalthnetstGvlnpl.....lakkhgallivDav..ssilarpidvdklgvdyasaqKnlGppG.
00453921   1/1  ypdlealeaaiepdtvaavivepvqgegGvivpppeflkalrelcrkhgillivDEvqtgfgrtgklfaf
00476701   1/1  rllGlgvrlvpvdengrmdleaLeeaieedtaaglipaavvatagttptGaidpleeiaeicrehgiwlh
00354011   1/1  ldlealeaalteapegglktklvllpnpnNPtGtvlsreeleellelarehglllivDeayaelvfdgap
00506961   1/1  vlvpsptYpaylaaarl....agakvvpvpldefgldlealeaalteakekgpktkaiilvpnpnNPtGa
00451711   1/1  eaalaeatektkllllnnpnNPtGavlsreeleelaelakehglllivDeayaglvyggeedapsllala
00358461   1/1  pealeealtelkpeglrplpktkavvltnp.nptGtvypleeiaelakkhglyllvDeAhgagayggpgr
00445231   1/1  vp.PtYplyaaaarl....agaevvevpldngflldleitpktkllllnnPnNPtGtvlsreelealae.
00519931   1/1  fsvr..waeiaerlgaevtvllpvdwggpvdleeieealdepdtklvalvhvetstGvlndikeiaelak
00460891   1/1  tepktkllllcnpnNPtGavlsreelealaelarkhdllvisDeaYadlvfdgapfpslasllpdlydrv
00503401   1/1  eeallnpdtklvavthneTstGvlnpleei.....dhgallvvDavsslgslpidvdklgvdf..fsaqK
00428091   1/1  apylyrteelgyndldaleallaehgekiaavivepvvqgegGvivpppeflkalrelcdkhgilliaDE
00507681   1/1  eatpktkliylvpnpnNPtGavlsleeleallelarkhdllvieDeayaelvydgapfpslasldapdrv
00428061   1/1  lteapektkllllnnpnNPtGtvlsleelkalaelakehgillvvDeaYagfafggeedapsilelagag
00529431   1/1  yndlealeallaehgdeiaavivepvqgegGvivpppgflealrelcdehgallivDEvqtGfgrtg.lf
00462551   1/1  tYpgylaaarl....agakvvpvpldeengflflldlleleaaitpktkllllcnPnNPtGavlsreele
00521571   1/1  ltgspadrlgfapllggvrlpapdtyrvpy----------------------------------------
00475811   1/1  ddvhfprtrlvslentqntegGtvypleeleeiaelArehglllhlDGARlanalvalgvslaelaglvd
00350731   1/1  dallaalesatektkllllnsphNPtGtvltpeelkelaelakehgllvivDeaYqgf------------
00509771   1/1  qilvtnGatealalllralldpgdevlvpdptYpgylaa....aelagakvvpvpldeeggflldleale
00456391   1/1  eatektkllllnnphNPtGavlsreelkelaelakehdlllisDeaYqgfvydgleed------------
00517231   1/1  eklakehkpklivag.aSaygrladlkrlreiadevgalllvDaAhiaGlvaggllpsple.gadvvttt
00450681   1/1  lteapektkllllnnpnNPtGtvlsreelkelaelakehglllivDeaYqgfaydgld------------


                         -         -         -         +         -         -         -:280
query           SDEKIAEKLAFLQNSIGSTLGPDDSWLIQRGIKTLGARMRVHHANTEAIIKFLENDDRVARILYPGLPDF
00462061   1/1  gnpellaallkvlprllggplspfqaalllrgletlplrverhtenalalaellaalplvakvlypglps
00523021   1/1  tGdrlGglvvtndkelierlrplrsggtsisyvglvtldllprrfeagtpnvagliglgaalsplqaall
00380341   1/1  gdrlgGyvvgsde.liealrklrlgggfggtlspaaaaallrgletlelrrarlrenadllaeaLaelpg
00412601   1/1  gdlriGyvvgnde.lidalrklrgpltgstlspaaaaaalrgletlelrrerlaenaallaeaLeelgpg
00367801   1/1  gpgdlrgGyvagsee.liealrklrpggglggtlspaaaaallrgletlelrreraqenadylaelLeel
00511951   1/1  lggpgdlrgGylvgs.eeliealrklllggglggtlspaaaaaalagletleerrarlrenadrlaeaLa
00473401   1/1  eayaagllgdplelgadivvgslsKylgghgdlraGylagreelidklrgllvglgggtlspaaaaalla
00489521   1/1  slsKalggpaGlrgGalvgnd.eliealrklrsggggtlsplaaaallaalegleerrerlrenadylae
00487471   1/1  lvgndelieallkllrggggggtlsplaaaallaaletleerlerlrenadllaeaLeelpgvtlvlypg
00461651   1/1  sKtlngpgGlrgGalvgnde.liealrkvrrglggtlsplaaaallaalegleerrerlrenadrlaeaL
00517571   1/1  Gp...rgGyiagk.kelieklrkvfpglggspsplvaaallaalktlllrgfkryleealklakal....
00405261   1/1  nNPtgtvld.......akehgilvivDeaYaepvydplplaydndivlrSfSKyf.glaGlrlGwavvpd
00421441   1/1  hehgallivDaaqaagalpldlgelgaDivvfsahKylggpg...lGallvrd.ellerlrpllhgggle
00408971   1/1  gg...gGavvtndeelaerlrklrnhglsrgllllvlaalllryevlllgynyrlspiqaaallaaletl
00459091   1/1  galykgkkvgsfgdivvfSfsktKnltgge...gGaivtndkelaeklrllrnhgtsksyhglkyvhlll
00401341   1/1  hglple.gadivvgslhKtlgGp...rgGailvrd.elaeklrsllfgggfggtlspllaaallaalell
00480741   1/1  elgaDivvfslhKalggppgv..Gallvr.kelieklrpllpgglldlvlalkylgavlgfftgtpnilg
00459731   1/1  vfvdvddetgnidledleaaitepktkaiiv..vasnp.GviadleeiaeiakkhgallivDaAhalgav
00527311   1/1  galykgkklgsfgdivvfSfhatKnltgge...gGavvtndkelaeklrllrnhgisrdglrkyvhlllg
00495241   1/1  lvivDaaqaagalpidldelgaDfvvfsahKwlgppG...iGalyvrkelldkllpllrggggivlvslf
00393411   1/1  dalgrdivvfSfsKtlglpglrvGylva..dpeliealrklrsgggstpsplaqaalaaaledgeehlee
00490701   1/1  llivDaaqaagllpldvgelgaDfvvfsghKtlgggppglGflyv..reellerlppllfgggtvadsfy
00507531   1/1  gaGalavre.ellralpgrlvgvtgdadgkralrlalqtreqhirrekgtsnictpnglaaaaalaaldl
00364061   1/1  tlgGp...rgGyiagkdelqelieklrrlkaplgfgtalspliaaaalaalelleegleelaerlvenaa
00440831   1/1  hgillivDeahaaglaytgklfgseyagvaigelvpdlfggadivsfslsKtlggp...rgGailtndee
00460071   1/1  ....rgGavlg.seelidalrplarggtfsgslnplaaaaalaalelleeegleelrerlaelaarlreg
00355891   1/1  vdivlgsfsKalglpGlrlGylva..dpeliealrklrsggtlgpsplaqaaaaaaledlelleehleel
00416741   1/1  algrvivlgSfsKalglpGlrlGylva..dpeliealrklrsggtfgpsplaqaaaaaaledeleelrer
00503901   1/1  leaaitprtkaiilpnpnNPtGavlsreelealaelarkhglllieDeayaelvydgkpfpslasldgey
00460561   1/1  dlgelgaDfvvfsghKllGppG..vGflyvrk..ellerlppllvgggqvaavsldlalqlrllerrfea
00448071   1/1  glgl..Gallvsee.llerlrpllsggtslyldlllllkyeqerrfragtpnplaaaallaalellleeg
00513231   1/1  aitpktkliilnnpnNPtGtvlsreelealaelakkhglllisDeayaelvydgapftsllslpdaldrv
00497541   1/1  ektkavileppnnptGvvlpleeleelaelarehgillivDeayagfvytgklpvslaellgvagadivv
00474411   1/1  gvdvvvgslqKalggppgl..Gflavspell.erleplsgylglallldlqekrfepgtppvlaiaalla
00502611   1/1  vilepnpnnptGvvlppeelealaelarehgallivDeayagfvytgkpagslaaldelgvdivlgslsK
00445951   1/1  PtGavldleelealaelarehgllvieDeayaelvydgpfpsladldagrvivlfSfsKtlglpGlrvGy
00520701   1/1  KalGp....rgGalags.eelidalrplarggtfsgtlnplaaaaalaalellgeegleelrerlralaa
00507541   1/1  lhKtlggpkgggGprlGallvrde.laealplrlggggergfvltldreqairrglagtgnalaiaaaaa
00501571   1/1  aleaaitpktaavileppqnptGvvlpspeyleelaelarehgallivDeayagfgrtglpfapealgvd
00465841   1/1  dlaglgvDivvfslhKalggpggi..Galyvrkelldrlrpllhgggslilvvrfdsltlqelglrfefg
00460871   1/1  aaikevgapktkliilenpvnpaGgsvysladlkaireiAdkyglllivDaAraagalyaggvtgspyaf
00417041   1/1  kaggfggadifsfslsKtlggg.g..gGalltndeelaerlrplrlggisidlkylvqelgfnsgtspia
00465471   1/1  DfvvfsghKalgppg...iGalyvrkell.lrpllvgggqerrfeagtpnvlaiaalaaalellgeglea
00389521   1/1  sldgallllpldlgrvivlgSfSKtlgl.pGlRlGylvakppeliealrklrsp..lsvsslaqaaaaaa
00423831   1/1  ggfllpfleklrpldfglpgvdsisvsghKyglaplgc..Gvvlvrdkellrealsvnadylggdlgsft
00355861   1/1  aqKnlgppG..lgvlivsedllerlepilpsyldlgtlaengstynTpptfaiyglglalkllkeeggle
00494861   1/1  DgayaggalpglgvsvaeldgaegadvvsfslhKtlggpg...gGallvrde.laealpllrggggetgr
00375691   1/1  sKtlglaGlRvGylva.ppeliealrklrsplgvstlaqaaaaaaledgllehleelrerlaerrdllle
00533351   1/1  eeleelaelakkhgillivDeayagfaydlggkgpsllelldlgpdvivlgSfsK---------------
00470951   1/1  elahehgallivDavqslgalpidvdelgvDflvssshKglggppGl..Gflyvsek.alerlknrklpp
00467471   1/1  eallkelreegpkpkliivegvfsmtGdiaplkelreladkygallivDeahaggvlgatGrgllehlgv
00460241   1/1  alppslasldglgrvivlgsfSKtfglpGlRlGylva..peeliealrklkgggllraltlsvstlaqaa
00528621   1/1  llpnpnNPtGtvlsleelealaelarkhglllivDeayaelvfdgepppslldal---------------
00479561   1/1  lrSlsKafglaGlRlGylvappeelieallklrsplgvstlaqaaaaaaledgeyleelrarlrerrdll
00521641   1/1  elahehgallvvDavqslgalpidvdelgvDllvasahKglggppG..lGflyvsedllerleplllggg
00500761   1/1  hglllhvDgArlgnalgalgvdlaeldgaegaDsvsfslhKglgapg...ggallgrdeliekarllrkr
00352461   1/1  gnldledLeklikehgadniaavileptqnptGgqvpsleylkelreiakkhgillilDearlaenayfg
00469651   1/1  llpnpnNPtGavlsleeleelaelarehgllvieDeayaelvydgkpapslasldglldrvivlgSfsKt
00461541   1/1  eealrertpaiivag.vsaygrladlkelreiadevgallivDaAhaaGlvaagvlpspfg.gadivtft
00485711   1/1  pdivtlshKalgG......G.av.gseelidalrpl...hggtfsg..nplaqaaalaalelleeee...
00357001   1/1  ..lgvvivsedllerle.......pilpgyldyktvakngstanTpptlaiyalgaalewlleeg..gle
00453921   1/1  ehlgvtpdivtlsKalgggglplgavlg..seeiadal..gpllhggtfggn.....placaaalaalel
00476701   1/1  vDaAygggalpfpeyrllldgiegaDsitfslhKwlgvp..lgcgallvrdkellrralsvdadylgsld
00354011   1/1  fpslaslllelglrllpdaygrvivlgsfsKtl.glpGlRlGylva.ppeliealrklksa.tlsvstla
00506961   1/1  vlsleeleallelarkhdllvieDeayaelvydgkpfpslasldepdrvivlgSfsKtl.lpGlRlGylv
00451711   1/1  dalprvivlgSfsKtfglpGlRvGylva..ppeliealakvksqllllirgltln---------------
00358461   1/1  glaehlglpplaleagadivvg------------------------------------------------
00445231   1/1  hgllvvsDeaYadlvydsalllleaydnlivlrsfSKaf.glaGlRlGylianpeliealrklrsplnvs
00519931   1/1  elshgallvvDavqslgalpidvdelgvDflvassqKgllgppG..lgflyvsera....lerleplllg
00460891   1/1  ivlrslSKtf.glpGlRlGylvapnpelieallklkspltlglvstlaqaaaaaa---------------
00503401   1/1  nlGppG...lgvlivskdllerlepl....gpsyld....lvtlak.....kgstanTppvlaiyalgla
00428091   1/1  vqtgfgrtgklfafehagvtpdivtlsKalgggglplgavlg..seeiadalapgalgaflhggtfggnp
00507681   1/1  ivlgsfSKtl..lpGlRlGylva.ppeliealrklrslltlgvsslaqaaaaaal---------------
00428061   1/1  pnvivlgSfsKtfglaGlRvGylva.paeliealakvlsqlklliraltsnppalaqaaaaaalsdgell
00529431   1/1  afehfgvtpdivtlgKalggGl.plgavlgs..aeimdalapg..........................g
00462551   1/1  alaelarkhgllvisDEiYadlvfdgepppsllldaydrvivlrslSKtfglaGl---------------
00521571   1/1  ----------------------------------------------------------------------
00475811   1/1  svsvglsKglga....pvGavlvgdkdliekarrlrkrlgggl.........rqagvlaaaalvaledll
00350731   1/1  ----------------------------------------------------------------------
00509771   1/1  aaltpktklvlltnPnNPtGtvlsleeleallelarkhgllvisDeayaelvydgpfpslasldgydrvi
00456391   1/1  ----------------------------------------------------------------------
00517231   1/1  thKtlrGpr-------------------------------------------------------------
00450681   1/1  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           PGHEVAKKQMDHFGAMISFELQEGLDTKKFVESLKVISLAESLGGIESLIEVPSVMTHGSIPREIRLENG
00462061   1/1  hpghllakrqlkglggllsfelkggleaakafldalklfviavslggveslilhpasttharlgpeeraa
00523021   1/1  lrgletldlrlerrrenadylaegLaelpgvelvlypglpshpghelakrqlpggaggllsfelkgdped
00380341   1/1  vvlvlypglpshpghelakrqlpggggivsfelkgdgedaeafadaLkeagiavspggafslilhpavtt
00412601   1/1  vevvlypglppegahylalrvlklpgaggivsfelkgdaealaalldelgiavrpgslggvesliihpas
00367801   1/1  glvvlvyypglpsgafyllaklpakgrggllsfelkgdaeavaklldelgvavrpgslggveslvihpal
00511951   1/1  elggvalvgypglpshpghelakkvlpgrggfvsfdlpgggedaeafadaLkeagiavspgsafslvlhp
00473401   1/1  aletlelrreralenadylaelLaelpgvylvgypglpshpghelakkvlpgrggfvsfdlkggvdaeal
00489521   1/1  aLaelggvelvlppglpshpghylavrlprglglllsfelpgdaelakalldelglagiavsfgsapsli
00487471   1/1  lpshpghelakklvpggggllsvelkdgedaeelldalkeagiavslgsafslillpasttllalglell
00461651   1/1  aelpgvervlypglpphggfflwvdlpegrgglvsfrlkdgidaealakaleeagifviavspgsafsli
00517571   1/1  ..aeylyeglkklpglegfkvvspgggnilsfilpvdlgd..gidalelaklllelygiavspgshp...
00405261   1/1  eelidklrklklpltigvsslaqlaalaalkdpldaylllrgesletlelrrerlrerrellaeaLeelg
00421441   1/1  krfeagtpnplaiaallaalellgeglealraralelaeyl..........regleelpglelvgppgrr
00408971   1/1  derlerrrenadrlaelLaelpgvelvkppglsshafylfailvlllglg............ldrdelae
00459091   1/1  gynyrlseiqAalglaqleklderlerrrenaklyaelLkklpgvelpkppglashsayylfpillkdgl
00401341   1/1  eeglkerrerlvenaarlaeaLeelgfvvvvgppd.................ghlvsvdlpgl.....gi
00480741   1/1  iaalaaalellgeeg.gleeilerlreladylyeglkel.glellgpdgrgrggivsfrlpdgidaaaka
00459731   1/1  gldvlpgplg.gaDivsfslhKtlggp...pGGallvnd.elieklrplrvgglfdlekligrarryffs
00527311   1/1  ynyrlseiqAalglaqleklderlerrrenaklyaelLkdlpgvklpkypglassvyh............
00495241   1/1  gltaaeqerrfeagtpnvaaiaalaaalellqeegleairerhreladyllegLkelpgvllvgppgasy
00393411   1/1  lrerlrerrdllaeaLaelpgvevvgppg.................gfflwvdlpglgldaeelaeaLle
00490701   1/1  ldltlqpaeqerrfeagtpnvaliaalaaalellglegleaiaarhleladylaegLaalpavpglellg
00507531   1/1  lgleglearaeralalanylaaaLeelpgv.rvlgpg...............gaghevsfdl..gvdaed
00364061   1/1  ylaegLkelgfvvvvgppg.................ghivlvdlpgdgidakalakaLeeagiavrpgsf
00440831   1/1  ladklrklrfpgegfplgggyrgspiaaaaallalelleellerrvenakylaeaLeel.gvpvv.gpv.
00460071   1/1  Lael.........glevvpgl..........glivpvelgdgldalalaeall......erGilvrpisy
00355891   1/1  rerlrerrdrlaealaelg..levvgpg................gglflwvdlpdlgldaeelaeallea
00416741   1/1  lrerrdllaeaLeelg..levvgps..............ggfflwldlp...gldaeelaealleagvlv
00503901   1/1  grvivlgSfsKtlglpGlRlGyvva..ppeliealrklrsaltlgvsplaqaaaaaaledgelrlerlee
00460561   1/1  gtpniagiaallaalellgeegleairarlraladylae..........gLaalpglellgp..errggi
00448071   1/1  lealrarlaeladylaegLeelg.lelvgppgr..............rsgllvsfdlpdgvdaeelakaL
00513231   1/1  ivlrSfSKtfglpGlRvGylva..ppeliealrklksalglgvstlaqaaaaaaledgllglegdeehle
00497541   1/1  gSfsKal.glpGlrlGalvg.deelidalrklrrggtftlsplaqaaalaaledleehleelrerlrelr
00474411   1/1  alellleegle.rrarlaeladalragleal.glell..peg..............rsggvvsfrlpdgi
00502611   1/1  tlggglrl..Galvg.deeliealrklrhggtftgnplaqaaalaaledlaleehleelrarlrerrdrl
00445951   1/1  lva..ppeliealrklrslgglgvstlaqaaaaaaledglflehleelrarlrerrdllleaLael..gl
00520701   1/1  ylaegLael.glpvv..ggl................gaivlvdlgdgvdakalaaallleaGilvrpgsa
00507541   1/1  alrllgeeglkelaerlveladylaegLkelpgv.evvgpg................gghlvafdlppgv
00501571   1/1  ivigslsKalggglgl..Gavlgsd.eladalrplrrgltfggnplaaaaalaalelleee.........
00465841   1/1  tppvaaaaalgaalelleeeglleairerlreladylregLeelpglelvgppg...............g
00460871   1/1  rsigeivdeifgyadivsfslsKglggp...rgGaivtndeelakkarklrfpg.......egfllgggp
00417041   1/1  aaaglaalegleeilerrreladylaeaLkelpglelvgppglsaphlfpvllplpeltelllplgglll
00465471   1/1  irarlleladylle..........gLkelpglellgppg.rrgnivsfrlp.gvdaedlakallekgiav
00389521   1/1  ledggfleehleelrerlrerrdllleaLee.pgl.evlppe............................
00423831   1/1  legsrpgaralalwaallslgregyeelverilelarylaelLeklggfells...............dg
00355861   1/1  arikrhaeladllydalealglvllvvdpelrsp..............mvvtfrlpdgvdakkflkllke
00494861   1/1  rsg.llaaaalaalg.........legleelaarlreladylaegLael.glelvgppg...anivfvdl
00375691   1/1  aLeelglvsvvgpsg.................glflwvdlp...daeelaealleegvavrpgsaf....
00533351   1/1  ----------------------------------------------------------------------
00470951   1/1  lsgggdlllllkfm.....ladqerrfeagTppvaliaalaaalellleeGleairarhreladalregl
00467471   1/1  lpdadivtgtlsKalggg.rg..Gailgs.kelidklrslarpgifstslnplaaaaalaalelleegee
00460241   1/1  aaaaledgleehleelrerlrerrdllaealeelpglevvppeg.................gfflwvdlp
00528621   1/1  ----------------------------------------------------------------------
00479561   1/1  aealeelg..lkvlkps................ggfflwldlp..ldaeelaerlleegvlvrpgsafg.
00521641   1/1  slyldlkllldyllayqergfeagTppvaliyalgaalelllee..gleairarhreladalregleal.
00500761   1/1  lggllrqag..llaaaalaalge.........egleellaranalarrlaegLaalpglelvg...ppet
00352461   1/1  fgrtgslfaleiagivpdiltladvvtfslsKgggapg...Ggvlatgdkel------------------
00469651   1/1  fglpGlRlGylva..ppeliealrklrspgnssvstlaqaaaaaaledgeflehleelrerlrerrdlll
00461541   1/1  thKtlrGp...rgGailtrdelldellrllrgfgfdlakkinsavfpglqggplnhviaalaaalklaql
00485711   1/1  .....llerlreladylregLaellaklpglvvdvpg...gglflgvelpdgvdaealaeallerGvlvv
00357001   1/1  aiearhaelaallyealdalglvyllvvdpelrs.............gmvvsftlpdgvlakaflkllke
00453921   1/1  leee.....ellerlrelgdyllegleell..lplvgdvrglGlmlgielvsddgllalalaalllerGv
00476701   1/1  dggdgvrdlrdftle.....gsrrfr.alklwaalralgreglrelierlielarylaegLrelpgfell
00354011   1/1  qaaaaaaledgelleehl----------------------------------------------------
00506961   1/1  a..ppeliealrklrsgltlgvstlaqaaaaaaledggyeehleelrarlrerrdlllealkellppgl.
00451711   1/1  ----------------------------------------------------------------------
00358461   1/1  ----------------------------------------------------------------------
00445231   1/1  tlaqaaaaaalsdldyleelrerlrerrdllveaLael.glevlppeggfylfldls.ldaeelaerlle
00519931   1/1  ggsisfyldlklllkymeayeqekgfeagTppvlliaalgaalellleegleairarhaelaealragle
00460891   1/1  ----------------------------------------------------------------------
00503401   1/1  lewlkeeggleaiekrhaelakllydaldalglvyllgvdpelrsptvvtfnlpdgvdakdflklldeag
00428091   1/1  la............caaalaalelleeedllerlaelgarlregleelaahplvgdv.rglglmlgielv
00507681   1/1  ----------------------------------------------------------------------
00428061   1/1  elwleeleelrerlaerrdllveaLaelggpgdldvikpqggfflfldlpd..............efvar
00529431   1/1  pglhggtfsgnplacaaalaalellee..edllerlaelgeylregleellakhp.lvgdvrglGlmlgl
00462551   1/1  ----------------------------------------------------------------------
00521571   1/1  ----------------------------------------------------------------------
00475811   1/1  el...lae--------------------------------------------------------------
00350731   1/1  ----------------------------------------------------------------------
00509771   1/1  vlgsfSKtfglpGlRlGy----------------------------------------------------
00456391   1/1  ----------------------------------------------------------------------
00517231   1/1  ----------------------------------------------------------------------
00450681   1/1  ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           IKDELIRLSVGIEDEEDLINDLKQALDKIG----------------------------------------
00462061   1/1  agiteglvRlsvgledtedliadLlqALe-----------------------------------------
00523021   1/1  akalldalklfgiavslggafslilhp-------------------------------------------
00380341   1/1  haalpleeraaagigpgllRlsvgledte-----------------------------------------
00412601   1/1  tthaqlglelraaagigegllRlsvgledte---------------------------------------
00367801   1/1  tthrqlslelradagigpgliRlsvglen-----------------------------------------
00511951   1/1  astthlrlglelraaaglgegllRlsvgl-----------------------------------------
00473401   1/1  adaLeeagiavslgsafslilhpasttha-----------------------------------------
00489521   1/1  lhpasttgshlllalglalglapgllRls-----------------------------------------
00487471   1/1  lalgisegllrlsvgleltedliddlleaL----------------------------------------
00461651   1/1  lhpapsthllalgllea..glapgllRlsv----------------------------------------
00517571   1/1  .............gvpdgliRlsvgslghtee--------------------------------------
00405261   1/1  ...gvsypglpshpyhelakkvlpggafy-----------------------------------------
00421441   1/1  lggivsfelp.gvdaedl..lllergiavs----------------------------------------
00408971   1/1  aLeeagiavvpgya.plhlqpaytt.g-------------------------------------------
00459091   1/1  glsrdellefllkkgietrphypplhlqp-----------------------------------------
00401341   1/1  daldlakaLeeagiavrlgshPavptgar.----------------------------------------
00480741   1/1  lakalleagiavspgsa............-----------------------------------------
00459731   1/1  gtppgarlaalaaalgllglegleerler-----------------------------------------
00527311   1/1  lfsillkdgleasrdeliealkekgiltr-----------------------------------------
00495241   1/1  rlpvtlsflgggvdaeallklldeagiav-----------------------------------------
00393411   1/1  eagvavrpgsaf................------------------------------------------
00490701   1/1  ppdaarr..........gglvsfrlpg...ae--------------------------------------
00507531   1/1  vakallerGvavstgsfp........--------------------------------------------
00364061   1/1  ptvpegsgvtsglrigtpaltarglseeef..--------------------------------------
00440831   1/1  .............gghgvfldlellldgi-----------------------------------------
00460071   1/1  pav..............plgegrlRlslgl----------------------------------------
00355891   1/1  gvlvrpgsaf................--------------------------------------------
00416741   1/1  rpgsaf......................------------------------------------------
00503901   1/1  hleelrarlrerrdllaealeelg..lk------------------------------------------
00460561   1/1  vsfrlp.g......vdaedlakaldeygia----------------------------------------
00448071   1/1  leeygiavspgsafa...sp.......-------------------------------------------
00513231   1/1  elrerlrerrdllaeaLeelg..lkvlpp-----------------------------------------
00497541   1/1  drlaeaLeel.gl.evlvpg.........-----------------------------------------
00474411   1/1  daaalakaleeagiavspgsafl.......----------------------------------------
00502611   1/1  aeaLeel..........lpdlpglevvgpg----------------------------------------
00445951   1/1  rvlkpeggfflwldlp..........--------------------------------------------
00520701   1/1  pav....................plg--------------------------------------------
00507541   1/1  daedlakrLleaGilvspgsap.......-----------------------------------------
00501571   1/1  ...elrerlreladylaegLael.gle-------------------------------------------
00465841   1/1  rgpivsfelpggvdaeelakaLdeagiav-----------------------------------------
00460871   1/1  rqhgiaaaaallalaeleeylerrhenary----------------------------------------
00417041   1/1  wlflleg.......idreelakallea-------------------------------------------
00465471   1/1  rpgsaca....sgllepslvllalgldgl-----------------------------------------
00389521   1/1  ...................gglflwvdl------------------------------------------
00423831   1/1  epalpvvafrlkpgdallplldaadlser-----------------------------------------
00355861   1/1  agi.avlgGhrsl.................----------------------------------------
00494861   1/1  p.gvdaeelaaalleagiavspgg.....-----------------------------------------
00375691   1/1  ..................gvgpgylRl-------------------------------------------
00533351   1/1  ----------------------------------------------------------------------
00470951   1/1  eal.glellgpdpaarspgvvsfrlpegvd----------------------------------------
00467471   1/1  lrerlrenaeylregLeel.........gl----------------------------------------
00460241   1/1  elllktgldaeelaerlleeagvavrpgs-----------------------------------------
00528621   1/1  ----------------------------------------------------------------------
00479561   1/1  ....................llgegy--------------------------------------------
00521641   1/1  glellgpdpelrspgvvsfrlpegvdaeel----------------------------------------
00500761   1/1  nivffrlpg..ellerllergiavsp--------------------------------------------
00352461   1/1  ----------------------------------------------------------------------
00469651   1/1  eaLaelg..levlppe.............-----------------------------------------
00461541   1/1  eefkeyaeqvvanaralaeaLael.gfk------------------------------------------
00485711   1/1  pgg..........................-----------------------------------------
00357001   1/1  egiavlkGhrcv..................----------------------------------------
00453921   1/1  llrpgg.......................-----------------------------------------
00476701   1/1  ge...pelglvvfrlkpadalnlalaerl-----------------------------------------
00354011   1/1  ----------------------------------------------------------------------
00506961   1/1  evvppe................ggfflw------------------------------------------
00451711   1/1  ----------------------------------------------------------------------
00358461   1/1  ----------------------------------------------------------------------
00445231   1/1  e.gvlvrpg.................--------------------------------------------
00519931   1/1  al.glellgpladpelrsptvtavkgpeg-----------------------------------------
00460891   1/1  ----------------------------------------------------------------------
00503401   1/1  iavlkGhrca...................-----------------------------------------
00428091   1/1  ddela-----------------------------------------------------------------
00507681   1/1  ----------------------------------------------------------------------
00428061   1/1  llleagvl--------------------------------------------------------------
00529431   1/1  elvkd-----------------------------------------------------------------
00462551   1/1  ----------------------------------------------------------------------
00521571   1/1  ----------------------------------------------------------------------
00475811   1/1  ----------------------------------------------------------------------
00350731   1/1  ----------------------------------------------------------------------
00509771   1/1  ----------------------------------------------------------------------
00456391   1/1  ----------------------------------------------------------------------
00517231   1/1  ----------------------------------------------------------------------
00450681   1/1  ----------------------------------------------------------------------