[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for lsal0:ABD98930.1


[Show Plain Result]

## Summary of Sequence Search
   1::362
   3::237  2.2e-75 44.0% 0037898 00378981 1/1   p containing nucleoside triphosphate hy 
   3::238  1.1e-73 44.1% 0042070 00420701 1/1   p containing nucleoside triphosphate hy 
   6::238  3.9e-72 44.4% 0042557 00425571 1/1   p containing nucleoside triphosphate hy 
  13::247  4.8e-72 47.3% 0048545 00485451 1/1   p containing nucleoside triphosphate hy 
   2::228  6.3e-72 45.8% 0037958 00379581 1/1   p containing nucleoside triphosphate hy 
  12::239  8.9e-72 44.3% 0050044 00500441 1/1   p containing nucleoside triphosphate hy 
   8::219  2.9e-70 38.5% 0039041 00390411 1/1   p containing nucleoside triphosphate hy 
   3::223  1.6e-69 44.7% 0042280 00422801 1/1   p containing nucleoside triphosphate hy 
   1::269  3.1e-69 37.8% 0049537 00495371 1/1   p containing nucleoside triphosphate hy 
   3::261  5.4e-69 37.1% 0049080 00490801 1/1   p containing nucleoside triphosphate hy 
   3::262  7.3e-69 37.4% 0051025 00510251 1/1   p containing nucleoside triphosphate hy 
   1::234  1.1e-68 42.9% 0044086 00440861 1/1   p containing nucleoside triphosphate hy 
   1::242  2.6e-68 43.6% 0036121 00361211 1/1   p containing nucleoside triphosphate hy 
  12::228  1.4e-67 44.4% 0047589 00475891 1/1   p containing nucleoside triphosphate hy 
   3::241  2.5e-67 43.5% 0048220 00482201 1/1   p containing nucleoside triphosphate hy 
   4::246  3.6e-67 39.0% 0045860 00458601 1/1   p containing nucleoside triphosphate hy 
   4::242  5.2e-67 42.6% 0050274 00502741 1/1   p containing nucleoside triphosphate hy 
   1::268  1.7e-66 37.6% 0049825 00498251 1/1   p containing nucleoside triphosphate hy 
   4::242    3e-66 43.1% 0048226 00482261 1/1   p containing nucleoside triphosphate hy 
   6::223  3.2e-66 42.9% 0036790 00367901 1/1   p containing nucleoside triphosphate hy 
   7::236  5.3e-66 44.6% 0040410 00404101 1/1   p containing nucleoside triphosphate hy 
   1::238  7.7e-65 38.5% 0050943 00509431 1/1   p containing nucleoside triphosphate hy 
   5::228  1.5e-64 44.6% 0047599 00475991 1/1   p containing nucleoside triphosphate hy 
   5::228  1.7e-64 45.5% 0053059 00530591 1/1   p containing nucleoside triphosphate hy 
   4::211  2.6e-64 45.5% 0043607 00436071 1/1   p containing nucleoside triphosphate hy 
   1::224  1.8e-62 45.0% 0046697 00466971 1/1   p containing nucleoside triphosphate hy 
  10::223  3.5e-61 41.3% 0046693 00466931 1/1   p containing nucleoside triphosphate hy 
   3::224  5.2e-61 42.5% 0042496 00424961 1/1   p containing nucleoside triphosphate hy 
   2::272  2.2e-59 37.3% 0050061 00500611 1/1   p containing nucleoside triphosphate hy 
   4::249  2.3e-59 42.4% 0046945 00469451 1/1   p containing nucleoside triphosphate hy 
   1::241  1.3e-58 39.0% 0046869 00468691 1/1   p containing nucleoside triphosphate hy 
   3::243  1.7e-58 44.3% 0037230 00372301 1/1   p containing nucleoside triphosphate hy 
   1::233    4e-58 39.8% 0048852 00488521 1/1   p containing nucleoside triphosphate hy 
   8::239  8.7e-57 44.3% 0049611 00496111 1/1   p containing nucleoside triphosphate hy 
  30::244  8.4e-56 40.2% 0045731 00457311 1/1   p containing nucleoside triphosphate hy 
   1::270  4.7e-55 34.7% 0049503 00495031 1/1   p containing nucleoside triphosphate hy 
   1::205  8.4e-54 40.6% 0043651 00436511 1/1   p containing nucleoside triphosphate hy 
   3::233  2.2e-52 38.7% 0037960 00379601 1/1   p containing nucleoside triphosphate hy 
   2::225  3.8e-52 42.1% 0036748 00367481 1/1   p containing nucleoside triphosphate hy 
  31::231  7.5e-52 40.1% 0049343 00493431 1/1   p containing nucleoside triphosphate hy 
  19::238  1.3e-50 44.3% 0053253 00532531 1/1   arboxykinase-like                       
  27::228  1.4e-50 44.5% 0048593 00485931 1/1   p containing nucleoside triphosphate hy 
  22::234  2.9e-50 44.0% 0044893 00448931 1/1   p containing nucleoside triphosphate hy 
  21::226  9.3e-50 39.3% 0050337 00503371 1/1   p containing nucleoside triphosphate hy 
   2::236    1e-49 40.1% 0042214 00422141 1/1   p containing nucleoside triphosphate hy 
  24::228  2.1e-48 40.5% 0046860 00468601 1/1   p containing nucleoside triphosphate hy 
   2::228  1.7e-46 41.7% 0043798 00437981 1/1   p containing nucleoside triphosphate hy 
  29::243  3.9e-46 43.5% 0048702 00487021 1/1   p containing nucleoside triphosphate hy 
  18::200  4.9e-46 43.4% 0047841 00478411 1/1   arboxykinase-like                       
  18::185    7e-46 45.6% 0047552 00475521 1/1   arboxykinase-like                       
  32::183  6.8e-45 42.0% 0038144 00381441 1/1   p containing nucleoside triphosphate hy 
   5::222    1e-44 35.0% 0037163 00371631 1/1   p containing nucleoside triphosphate hy 
  30::209  5.4e-44 39.7% 0047797 00477971 1/1   p containing nucleoside triphosphate hy 
  21::236  5.6e-42 35.2% 0047537 00475371 1/1   p containing nucleoside triphosphate hy 
   3::237  6.7e-42 31.4% 0036850 00368501 1/1   p containing nucleoside triphosphate hy 
   4::234  7.6e-42 34.5% 0046479 00464791 1/1   p containing nucleoside triphosphate hy 
  32::242  1.4e-41 34.7% 0053350 00533501 1/1   p containing nucleoside triphosphate hy 
  18::199  1.8e-40 40.1% 0047844 00478441 1/1   arboxykinase-like                       
  15::217  3.1e-40 34.7% 0046276 00462761 1/1   p containing nucleoside triphosphate hy 
  30::231  1.1e-39 35.4% 0046441 00464411 1/1   p containing nucleoside triphosphate hy 
  30::239  1.2e-39 35.6% 0041412 00414121 1/1   p containing nucleoside triphosphate hy 
  31::239  7.6e-39 34.5% 0049657 00496571 1/1   p containing nucleoside triphosphate hy 
  30::215  3.8e-38 36.5% 0042605 00426051 1/1   p containing nucleoside triphosphate hy 
  31::202  3.9e-38 44.9% 0047538 00475381 1/1   p containing nucleoside triphosphate hy 
  26::168  8.1e-38 44.0% 0048047 00480471 1/1   p containing nucleoside triphosphate hy 
  24::232  2.2e-35 31.1% 0046895 00468951 1/1   p containing nucleoside triphosphate hy 
  31::189  2.2e-35 40.8% 0051553 00515531 1/1   p containing nucleoside triphosphate hy 
   6::226  8.4e-35 44.0% 0043794 00437941 1/1   p containing nucleoside triphosphate hy 
   1::126  2.1e-34 41.2% 0038720 00387201 1/1   p containing nucleoside triphosphate hy 
   3::232  7.2e-34 30.9% 0037996 00379961 1/1   p containing nucleoside triphosphate hy 
  24::235  1.6e-33 27.6% 0051056 00510561 1/1   p containing nucleoside triphosphate hy 
   3::241  4.7e-33 26.9% 0047073 00470731 1/1   p containing nucleoside triphosphate hy 
  33::221  4.2e-32 34.4% 0051289 00512891 1/1   p containing nucleoside triphosphate hy 
   8::217  8.5e-32 28.4% 0050374 00503741 1/1   p containing nucleoside triphosphate hy 
  31::185  1.6e-31 38.7% 0051551 00515511 1/1   p containing nucleoside triphosphate hy 
   4::237    3e-31 27.4% 0037926 00379261 1/1   p containing nucleoside triphosphate hy 
  33::219  3.7e-31 27.5% 0048044 00480441 1/1   p containing nucleoside triphosphate hy 
  32::213  4.1e-31 29.5% 0049881 00498811 1/1   p containing nucleoside triphosphate hy 
   9::255  5.1e-31 29.6% 0048957 00489571 1/1   p containing nucleoside triphosphate hy 
  24::228  5.2e-31 32.3% 0049073 00490731 1/1   p containing nucleoside triphosphate hy 
  31::239  5.6e-31 33.7% 0053247 00532471 1/1   p containing nucleoside triphosphate hy 
  24::242  1.1e-30 27.7% 0049853 00498531 1/1   p containing nucleoside triphosphate hy 
   8::194  8.1e-30 35.0% 0035641 00356411 1/1   p containing nucleoside triphosphate hy 
  11::211  1.8e-29 33.7% 0043440 00434401 1/1   p containing nucleoside triphosphate hy 
   9::235    2e-29 36.0% 0039270 00392701 1/1   p containing nucleoside triphosphate hy 
  26::242  3.9e-27 27.1% 0049933 00499331 1/1   p containing nucleoside triphosphate hy 
   9::213  5.8e-27 34.5% 0040678 00406781 1/1   p containing nucleoside triphosphate hy 
  31::193  6.4e-27 34.8% 0048410 00484101 1/1   p containing nucleoside triphosphate hy 
  23::213  6.7e-27 29.7% 0036857 00368571 1/1   p containing nucleoside triphosphate hy 
   2::256  7.2e-27 31.7% 0040419 00404191 1/1   p containing nucleoside triphosphate hy 
  23::191  4.7e-26 36.6% 0050867 00508671 1/1   p containing nucleoside triphosphate hy 
  23::254  5.7e-26 32.5% 0042094 00420941 1/1   p containing nucleoside triphosphate hy 
  31::202  2.9e-25 42.7% 0049919 00499191 1/1   p containing nucleoside triphosphate hy 
   1::231  5.2e-25 32.7% 0044438 00444381 1/1   p containing nucleoside triphosphate hy 
  10::195  4.8e-24 27.7% 0047701 00477011 1/1   p containing nucleoside triphosphate hy 
  26::214  2.8e-23 27.1% 0053315 00533151 1/1   p containing nucleoside triphosphate hy 
  31::237  1.4e-22 27.3% 0048963 00489631 1/1   p containing nucleoside triphosphate hy 
  27::194  5.2e-22 34.2% 0045157 00451571 1/1   p containing nucleoside triphosphate hy 
  32::230  3.4e-21 31.1% 0051535 00515351 1/1   p containing nucleoside triphosphate hy 
   4::198  7.4e-21 31.2% 0043790 00437901 1/1   p containing nucleoside triphosphate hy 
  24::241  8.5e-21 24.1% 0048025 00480251 1/1   p containing nucleoside triphosphate hy 
  32::225  1.9e-20 26.1% 0040588 00405881 1/1   p containing nucleoside triphosphate hy 
  29::272  6.9e-20 20.3% 0048255 00482551 1/1   p containing nucleoside triphosphate hy 
   8::198    7e-20 31.6% 0039472 00394721 1/1   p containing nucleoside triphosphate hy 
  33::207  8.1e-20 28.5% 0051376 00513761 1/1   p containing nucleoside triphosphate hy 
   6::199  9.5e-20 30.8% 0036729 00367291 1/1   p containing nucleoside triphosphate hy 
  10::199  4.4e-19 38.7% 0038674 00386741 1/1   p containing nucleoside triphosphate hy 
   6::199  1.5e-18 34.4% 0052155 00521551 1/1   p containing nucleoside triphosphate hy 
  28::202  6.6e-18 32.5% 0047291 00472911 1/1   p containing nucleoside triphosphate hy 
  32::242  3.3e-17 25.9% 0049606 00496061 1/1   p containing nucleoside triphosphate hy 
  26::193  3.8e-17 40.7% 0043218 00432181 1/1   p containing nucleoside triphosphate hy 
  29::224  4.4e-17 25.3% 0043986 00439861 1/1   p containing nucleoside triphosphate hy 
   9::199  4.6e-17 31.1% 0047394 00473941 1/1   p containing nucleoside triphosphate hy 
  19::226  4.7e-17 27.8% 0051325 00513251 1/1   p containing nucleoside triphosphate hy 
  11::231  6.9e-17 29.3% 0040237 00402371 1/1   p containing nucleoside triphosphate hy 
  20::198  1.6e-16 29.3% 0043792 00437921 1/1   p containing nucleoside triphosphate hy 
  20::196  8.7e-16 24.7% 0052726 00527261 1/1   p containing nucleoside triphosphate hy 
  31::211  2.9e-15 26.5% 0045785 00457851 1/1   p containing nucleoside triphosphate hy 
  31::213  6.4e-15 25.5% 0045788 00457881 1/1   p containing nucleoside triphosphate hy 
 239::344  7.7e-15 28.0% 0048658 00486581 1/1   ike                                     
  33::202  9.8e-15 31.9% 0046916 00469161 1/1   p containing nucleoside triphosphate hy 
  31::241  1.2e-14 26.1% 0051958 00519581 1/1   p containing nucleoside triphosphate hy 
  28::202  1.3e-14 29.5% 0047839 00478391 1/1   p containing nucleoside triphosphate hy 
  27::202  1.6e-14 29.6% 0048939 00489391 1/1   p containing nucleoside triphosphate hy 
  32::202  1.6e-14 30.1% 0047607 00476071 1/1   p containing nucleoside triphosphate hy 
   6::208  3.4e-14 25.7% 0043012 00430121 1/1   p containing nucleoside triphosphate hy 
  32::208    4e-14 28.0% 0047808 00478081 1/1   p containing nucleoside triphosphate hy 
  31::201  5.1e-14 29.2% 0046162 00461621 1/1   p containing nucleoside triphosphate hy 
  31::203  1.6e-13 28.9% 0048706 00487061 1/1   p containing nucleoside triphosphate hy 
   4::195  1.8e-13 31.0% 0041830 00418301 1/1   p containing nucleoside triphosphate hy 
  32::213  5.4e-13 24.6% 0048272 00482721 1/1   p containing nucleoside triphosphate hy 
  32::211  1.8e-12 24.8% 0049317 00493171 1/1   p containing nucleoside triphosphate hy 
  25::163  1.9e-12 35.1% 0051769 00517691 1/1   p containing nucleoside triphosphate hy 
   4::207  6.6e-12 25.5% 0041617 00416171 1/1   p containing nucleoside triphosphate hy 
  26::211    2e-11 26.6% 0051138 00511381 1/1   p containing nucleoside triphosphate hy 
   6::102  2.1e-11 33.3% 0049577 00495771 1/1   p containing nucleoside triphosphate hy 
  20::195  9.6e-11 26.2% 0041053 00410531 1/1   p containing nucleoside triphosphate hy 
  28::243    1e-10 21.5% 0051604 00516041 1/1   p containing nucleoside triphosphate hy 
  30::203  1.4e-10 26.4% 0047756 00477561 1/1   p containing nucleoside triphosphate hy 
  22::243  3.1e-10 23.3% 0049757 00497571 1/1   p containing nucleoside triphosphate hy 
   1::199  7.7e-10 25.7% 0046258 00462581 1/1   p containing nucleoside triphosphate hy 
   6::198  1.2e-09 29.1% 0048266 00482661 1/1   p containing nucleoside triphosphate hy 
   6::198  1.7e-09 21.1% 0047420 00474201 1/1   p containing nucleoside triphosphate hy 
  33::215  1.2e-08 21.3% 0046315 00463151 1/1   p containing nucleoside triphosphate hy 
  25::180  3.2e-08 29.6% 0040984 00409841 1/1   p containing nucleoside triphosphate hy 
  32::212    8e-08 28.1% 0048050 00480501 1/1   p containing nucleoside triphosphate hy 
 240::351  8.7e-08 21.4% 0048857 00488571 1/1   ike                                     
  33::180  1.5e-07 23.6% 0048692 00486921 1/1   p containing nucleoside triphosphate hy 
  31::202  2.8e-07 28.3% 0047772 00477721 1/1   p containing nucleoside triphosphate hy 
  32::202    4e-07 28.0% 0051206 00512061 1/1   p containing nucleoside triphosphate hy 
  32::232  5.7e-07 18.5% 0050989 00509891 1/1   p containing nucleoside triphosphate hy 
  28::163  6.9e-07 33.3% 0040121 00401211 1/1   p containing nucleoside triphosphate hy 
  33::202  7.5e-07 25.6% 0051580 00515801 1/1   p containing nucleoside triphosphate hy 
   4::86   1.3e-06 25.3% 0047127 00471271 1/1   p containing nucleoside triphosphate hy 
   6::199  1.5e-06 21.2% 0047665 00476651 1/1   p containing nucleoside triphosphate hy 
  32::202  1.5e-06 28.7% 0047813 00478131 1/1   p containing nucleoside triphosphate hy 
  32::202  1.7e-06 25.0% 0049398 00493981 1/1   p containing nucleoside triphosphate hy 
  16::54   1.8e-06 41.0% 0041032 00410321 1/1   p containing nucleoside triphosphate hy 
  32::212  3.8e-06 19.3% 0047933 00479331 1/1   p containing nucleoside triphosphate hy 
  36::67   5.6e-06 43.8% 0042008 00420081 1/1   p containing nucleoside triphosphate hy 
  33::202  5.8e-06 28.4% 0050194 00501941 1/1   p containing nucleoside triphosphate hy 
  32::202  7.8e-06 25.7% 0048381 00483811 1/1   p containing nucleoside triphosphate hy 
  33::202  1.2e-05 27.7% 0048689 00486891 1/1   p containing nucleoside triphosphate hy 
   8::63   1.9e-05 28.6% 0044125 00441251 1/1   p containing nucleoside triphosphate hy 
  33::100    3e-05 25.8% 0046459 00464591 1/1   p containing nucleoside triphosphate hy 
  31::202  4.4e-05 24.8% 0049190 00491901 1/1   p containing nucleoside triphosphate hy 
  17::54   7.2e-05 34.2% 0037862 00378621 1/1   p containing nucleoside triphosphate hy 
   7::162  7.8e-05 22.3% 0049053 00490531 1/1   p containing nucleoside triphosphate hy 
  33::53   0.00028 47.6% 0051851 00518511 1/1   p containing nucleoside triphosphate hy 
  33::53   0.00047 42.9% 0049306 00493061 1/1   p containing nucleoside triphosphate hy 
  32::53   0.00052 45.5% 0045970 00459701 1/1   p containing nucleoside triphosphate hy 
   3::53   0.00067 21.6% 0036317 00363171 1/1   p containing nucleoside triphosphate hy 
   6::199   0.0008 21.8% 0049491 00494911 1/1   p containing nucleoside triphosphate hy 
   7::162  0.00083 22.8% 0040238 00402381 1/1   p containing nucleoside triphosphate hy 
  30::53   0.00098 45.8% 0046442 00464421 1/1   p containing nucleoside triphosphate hy 
   1::362


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MKQPLISFKHVVKSYDDDVQVLKDVSFDIEEGKFYTLLGPSGCGKTTILNIIAGLSDATSGDVYFDGKRI
00378981   1/1  --lpllelenlsksy.ggvlalkdvsltvepgeivalvGpnGaGKSTllkllagllkptsGeilldgldl
00420701   1/1  --lpllelenlsksypgggvlalkdvsltvepgeivalvGpnGsGKSTllkllagllkptsGeilldgld
00425571   1/1  -----lelenlsksy.ggvlalkdvsltvepgeivalvGpnGaGKSTllkllagllkptsGeilldgldl
00485451   1/1  ------------skiygd..ealkdvsleikkllnlsgkpgeiigivGpsGsGKsTllrlLagllkplll
00379581   1/1  -lepllevenlsksy.ggvlalkdvsltvkpgeivalvGpnGsGKSTllkllagllkptsGeilldgldi
00500441   1/1  -----------lllelllelknlsksyggvlalddvsltikpgeivalvGpnGaGKSTllkllagllkpt
00390411   1/1  -------Mknlslrygn.fralkdvslelppG.ltalvGpNGsGKStLlkalagllgpdsglrvgklsdl
00422801   1/1  --llllllallllllllllldpllelenlsksyggrlvlalkdvsltvkpgeivalvGpnGsGKSTllkl
00495371   1/1  esalellleledltklstg.ikaLddv.lggglpkGeivlllGpsGsGKttlalrllagllkp...evlv
00490801   1/1  --llllllllalllelleeeeellllllalllllgdpllelenlsksy.ggvpalkdvsltikpGeival
00510251   1/1  --lllllllllaeellelleeeelllllllllllllgdpllelenlsksy.ggvpalkdvsltikpGeiv
00440861   1/1  Mpllslgepllelenlsksy.ggvvalkdislsipkGeildlldellellkeldgsllnvalvGpsGsGK
00361211   1/1  plellgepllelenlsksyg.gitalddvslgirkGeivllvGpsGsGKStllrnllagllaptggsvll
00475891   1/1  -----------lllelllevknlsksyggvlalkdvsltikpgeivalvGpnGsGKSTllkllagllkpt
00482201   1/1  --llllelknlsksy.ggvlalkdvsltikpgeivalvGpnGsGKSTllkllagllkptsGeilldgkdi
00458601   1/1  ---lllevenlsksyg.gvlalkdvsltikpgeivalvGpnGsGKSTllkllagllkptsGeilldgkdi
00502741   1/1  ---lllevenlsksy.ggvlalkdvsltikpgeivalvGpnGsGKSTllkllagllkptsGeilldgkdi
00498251   1/1  vekllglalllieklflkvlprllsllelenlskiy.tgipal.dvslglgGlppGeivlllGpsGsGKT
00482261   1/1  ---lllevenlsksy.ggvlalkdvsltikpgeivalvGpnGsGKSTllkllagllkptsGeilldgkdi
00367901   1/1  -----lelknlslsyg..ksilkdvsleip.geltalvGpnGsGKStllkalagllgpdvsallrlsgli
00404101   1/1  ------elenlsksy.ggvlalkdvsltvepgeivalvGpnGaGKSTllkllagll.ptsGeilldgldl
00509431   1/1  M....lelknlslsnfr...vlkdelvslefepg.ltaivGpNGsGKStlldalagllggrslrllragg
00475991   1/1  ----lllaaelpelgelllevvnlsksyg.gvlalkdvsltikpgeivalvGpnGsGKSTllkllagllk
00530591   1/1  ----llllllaleelpllgelllevknlsksyg.gvlalkdvsltikpgeivalvGpnGsGKSTllklla
00436071   1/1  ---pllelenlsksygg..lalkdvsltvepgeivalvGpnGaGKsTllkllagllkptsgeilldgldl
00466971   1/1  llalllevknlsksy.ggvlalkdvsltikpgeivalvGpnGsGKSTllkllagllkptsGeilldgkdi
00466931   1/1  ---------Mkllslslgnfralkdvslelp.geltalvGpNGsGKStLlkalagllgpdsGeilldgkd
00424961   1/1  --lgepldglgplrpapgllelenvsksygtg.ialidlslpigkGervalvGpsGaGKttLlrliagll
00500611   1/1  -pgllsllelllelenltklptg.ipaLddv.lgggipkGeivllvGpsGsGKTtlllqlagllapdsge
00469451   1/1  ---allelenlskiyggvpkalddvslgiepGeivalvGpsGsGKstllrllagllaglptsGeillldg
00468691   1/1  lsvpvglallgrvldvlgepidglgplllllllpivrlappllelenlsksy.gtgialidvsltigrGe
00372301   1/1  --yvlPllsdgmpllelenlrkpy.ggllvlndvsl...pgeivaltGpnGaGKSTllrllaglllpasg
00488521   1/1  lllllalelllevenlrist.gikeldkllsgglppgeitlivGpsGsGKTtLllqlavngllppdsGei
00496111   1/1  -------elenltkly.tgikaLddllslgippGeivllvGpsGsGKTtlalrllagllkptggkvliig
00457311   1/1  -----------------------------mkkgeiigivGpsGsGKSTlarllagllekpgsgvividgd
00495031   1/1  lsalellleledltkistg.ipaLddvlsggipkGelvllvGpsGsGKTtlllqlagllalglgliplgg
00436511   1/1  ievpvglallgrvldllgepidgkgplelgepllevenlsksyggrklvlepletgialddvsltikkGe
00379601   1/1  --edllelenlsfsygg.kealkdlslaiepgelvlivGptGsGKTTllkallgllppdegiitiegpde
00367481   1/1  -yvrPelldepllelengrhPllsksyg.gkvvlndislsip.gellvitGPngsGKSTllralaglllp
00493431   1/1  ------------------------------kGelivllGpsGaGKsTllkllagllgptsgvisvggttr
00532531   1/1  ------------------vlalkdvslviekGevvallGlSGsGKTTLlrllagllipddgeilidggdi
00485931   1/1  --------------------------LsvpkgevvalvGpnGaGKTTllallagllaptggkvllvgadi
00448931   1/1  ---------------------LddvslsvepgevialvGpnGsGKTTllnalagllapdggkvllvgadi
00503371   1/1  --------------------Mmlkslelknfkslkdvsligdfspg.ltaivGpNGsGKStlldaiagll
00422141   1/1  -dlsleelekllelllrdllglgplvklldplleeavvngasdihiepgggllrvryridgvlielifld
00468601   1/1  -----------------------dlslevkkgevialvGpnGvGKTTllakLagllapqggkvlllgaDi
00437981   1/1  -lveklrpknldkvi.gqeealkdlslalkpgeiphalllvGppGsGKttlaralagllgpdsgkilldg
00487021   1/1  ----------------------------rm...kiivltGpsGsGKsTlarlLaell....gvvvidtdd
00478411   1/1  -----------------Ggvlalhgvsldve.gevvlltGpsGsGKStllralagl.....Gtilldg.d
00475521   1/1  -----------------evlalhgvsldve.gevvllvGpsGsGKStllralag.....sGeilvdg.dl
00381441   1/1  -------------------------------GeliaivGpsGsGKsTLlklLagllppdsgsigslttrl
00371631   1/1  ----mseliiylelselewallradvgltlteaelkrlkglndlleledlskiygplsrlikllleellr
00477971   1/1  -----------------------------hkgelvvlvGPsGaGKsTLlnaLlgll.ptsgvisvsgttr
00475371   1/1  --------------------alddvslsikkgevialvGkgGvGKTTlaanlagllaptggkvlligaDi
00368501   1/1  --kerllllelrnvllddviGqeeakealsealelplkrpelfdglgvelpgknvlLvGppGvGKTtlar
00464791   1/1  ---lsvpvgdkllGrvldvlgepidglgpllalerlpierlappllelenlskrfgtgi.vlidvslpig
00533501   1/1  -------------------------------rgeiialtGpsGsGKsTlaklLaellphldtgdvlldge
00478441   1/1  -----------------aevlalhgvsldin.gegvlivGpsGsGKStlalaLagl.....Gailvdd.d
00462761   1/1  --------------yygdvtaldgvsltikkgevialvGpsGsGKsTlaraLagllpeepgsgvvlldgd
00464411   1/1  -----------------------------vkkgeiivllGpsGsGKsTlaklLagllgptggsvlltgep
00414121   1/1  -----------------------------kpgevvllvGpsGaGKTTLlrallglleglkvaviepdfge
00496571   1/1  ------------------------------GkgelivllGpsGsGKsTlarlLagll...ggsvldtgep
00426051   1/1  -----------------------------kpgevialvGpsGsGKSTlakllakelglefidsgdilrdg
00475381   1/1  ------------------------------mkgeiialtGpsGsGKsTlarlLagllkptsgivsvdglr
00480471   1/1  -------------------------sleikkgekvaivGpsGsGKSTLlnaLagllsptsvpettrdfil
00468951   1/1  -----------------------lnvlgesidalgkilseilkllekgfltalgllerksverlstgika
00515531   1/1  ------------------------------kgekvallGlsgsGKSTllnrllglefaygpTigptsgti
00437941   1/1  -----lrplveklrpknlddvygqe.evlkalslalekgrpehlllvGppGtGKTtlakalaglllptsg
00387201   1/1  mssgepllevenlskry.ggklalkdvslsvekgeivlLlGpnGaGKTtLlralagllgptsfvvsptft
00379961   1/1  --yrpvdfddivGqee....alralslalaagppegvllvGppGtGKstlaralagllppdsgrivlvgn
00510561   1/1  -----------------------ldglgepldgllpilaklfrpievlalgllerksverlstGikaLDl
00470731   1/1  --arpltfddvvgqdeakeeleel...lag.llgikkpkvillvGppGsGKTTlaralakel..gagfil
00512891   1/1  --------------------------------evilltGppGvGKTTlakalagelgakfgsvsltgrdv
00503741   1/1  -------fifldlrplallplpdrlvgrdeeiealskalgg...aldgvslsiepggivllvGppGvGKT
00515511   1/1  ------------------------------kgekvlllGlsgsGKSTllnrllgleflpgpTigptegti
00379261   1/1  ---drllleelrpvllddviGqeeakealsealrlplkrlelferlglrrpgknvlLvGppGvGKTtlar
00480441   1/1  --------------------------------rlivllGpsGaGKsTlaklLaellp...glivisvgdt
00498811   1/1  -------------------------------kPgkiigltGpsGsGKsTlarlLael.....gvividgd
00489571   1/1  --------rvknlsksy.ggktalddvslsvepG.ivgLlGpNGaGKSTllrllaGllkpt.........
00490731   1/1  -----------------------dvslsvkkgkvialvGkgGvGKTTlaaklagllakrggkvllidaDp
00532471   1/1  ------------------------------pGkiIvitGpsGsGKsTlarlLaellnglggivsvddlgr
00498531   1/1  -----------------------ldklgkildlalkileksflklevlalgvlerkeverlstGikaLDa
00356411   1/1  -------lknlsksyg.ilkalkdislelkkgikilllGlsgsGKSTllnrllgleygpTiginegtiei
00434401   1/1  ----------lsksygg.llalddvslsvkkgliigitGpsGsGKTTlaraLaellrerggsvavidldd
00392701   1/1  --------eklrpvllddvvgqeeakeallealagarlaledlslgirpgknvlLvGppGvGKTtlaral
00499331   1/1  -------------------------PslslkkgklivltGppGsGKtTlakaLaerl....glpfidtdd
00406781   1/1  --------eallealaglrlllkdlslgippgknvllvGppGtGKTtlakalagelgvpfvrisase...
00484101   1/1  ------------------------------kgpvigivGpsGsGKTTllraLagllkprggrvavigldi
00368571   1/1  ----------------------vpvtldlgelgrhllivGptGsGKStllrllaglllpdggrviviDpk
00404191   1/1  -vellpkvtlddlvgleelkealkealellslgikpgeivllyGppGtGKTtlakalanelkkrggrvly
00508671   1/1  ----------------------hvsllklgeldislsikkgevivlvGpsGsGKsTlaraLakrLeepgs
00420941   1/1  ----------------------lglslgirpgkgvllyGppGtGKTtlakalagelgapfiridg.....
00499191   1/1  ------------------------------kgkiigitGpsGsGKsTlaklLaellgatvgdvd......
00444381   1/1  asdelekllelrpvlledvigqeeakkalslalelplkrlelfgklddligrspairrllellgarpgen
00477011   1/1  ---------eelrklldlidklrdlllsldlglpkvaivGrsgsGKSTLlnallGldvlpvgggpgtrrp
00533151   1/1  -------------------------MsldikkgklivltGppGsGKtTlarlLaerl....glpfistdd
00489631   1/1  ------------------------------MkgklillvGppGsGKtTlaraLaellglpf..iridgdd
00451571   1/1  --------------------------MsikkgeiiaivGppGsGKsTlaklLakll....glivldgddl
00515351   1/1  -------------------------------mngklivltGppGsGKtTlaraLaerlglpvistddllr
00437901   1/1  ---slllvekyrpvllddvvgqeeakeallealalararplkrpelflslgirpgrillLyGppGvGKTt
00480251   1/1  -----------------------EdlslavgkgkvialvGkgGvGKTTtaakLaaalaergkkvllidlD
00405881   1/1  -------------------------------gervglvGrpgaGKSTLlnaltglk.aivsgypgttldp
00482551   1/1  ----------------------------everlstgipalDellgGglppgslvliaGppGsGKTtlalq
00394721   1/1  -------lvslleslelplleklrpvllddvvgreealeallealrrgpprnvlLvGppGvGKTtlakal
00513761   1/1  --------------------------------kiiaivGkgGsGKTTllnklaglla.dggkvlvidlDp
00367291   1/1  -----vtlddvv.gqeeakeallealelalkgldlflslglrpgrnvllyGppGtGKTtlaralanelga
00386741   1/1  ---------klrpvllddvvgqeeakeallealkavllgirpgehllLvGppGtGKTtlaralagelga.
00521551   1/1  -----plveklrpvllddvigqeeakeallealarlkapelflslglrpgkgvlLvGppGtGKTtlaral
00472911   1/1  ---------------------------mkmkkgklilltGppGsGKtTlaraLaellgapfisgddllrg
00496061   1/1  -------------------------------gklivltGppGsGKtTlaklLaerlglpvistddllre.
00432181   1/1  -------------------------slelkkglkvalvGrpgvGKStLlnallglkvaivsdypgttrdp
00439861   1/1  ----------------------------kleeveristgipeldellgGglpkgslilitGppGsGKTtl
00473941   1/1  --------eklrpvllddvvgqeevkkalllalalallrgepgehvlLvGppGtGKTtlaralagllga.
00513251   1/1  ------------------iellsdlslsipspevvllvGppGsGKstlakklaell....gfilidaddl
00402371   1/1  ----------vlektgipltkllrpvllddviGqeealeallealrr..rpgrnvllvGppGvGKTtlar
00437921   1/1  -------------------lglllveklrpkllddvvgqeealerlllalkagklphlllvGppGvGKTt
00527261   1/1  -------------------npfilgpkvdledfigreeelkeleeal..pkivlltGprGsGKTtllkal
00457851   1/1  ------------------------------PkgklivltGppGsGKtTlakaLaerlglpvistddllre
00457881   1/1  ------------------------------mgklivltGppGsGKtTlaklLaerlglpvidtddllrel
00486581   1/1  ----------------------------------------------------------------------
00469161   1/1  --------------------------------llIvieGppGsGKsTlaklLaerlgltglsvlltredg
00519581   1/1  ------------------------------kpkvilltGppGvGKttlarlLakllglpliidldalael
00478391   1/1  ---------------------------msikkgklilltGppGsGKtTlaralaerl....glpvidgdd
00489391   1/1  --------------------------lsikkgklivltGppGsGKtTlakaLaerl....glpvistddl
00476071   1/1  -------------------------------kgkiigltGpsGsGKsTlaklLaelglpvidtddltreg
00430121   1/1  -----iPvsklleddrplleklrpvlfddvvgqeeakeallealrrgrkglelgirpggnvllvGPpGvG
00478081   1/1  -------------------------------gkvivltGppGsGKtTlarlLaellkplgggvvvidtdd
00461621   1/1  ------------------------------mkgmiialtGppGsGKsTlaklLaerlglpfistddly..
00487061   1/1  ------------------------------ldMkkgklIvieGppGsGKtTlakaLaer.gargldvvvi
00418301   1/1  ---drplleklrpvllddviGqeeakkallealalplkrlelfeklrgirpgknvlLvGppGtGKTtlar
00482721   1/1  -------------------------------kgkiigltGpsGsGKsTlarlLaelglpvidtddlyrel
00493171   1/1  -------------------------------mgklivllGpsGaGKsTlaklLaeklglivlsv..gdtt
00517691   1/1  ------------------------lsfelkpglnvgivGhvgaGKSTLlnallgllgaivgdvlvdg...
00416171   1/1  ---diigqeeakka......llealslaartgenvllvGppGtGKttlaralakllprsgvpfvrvncsa
00511381   1/1  -------------------------llllkpgglvlitGPtgsGKsttLlralnrleeagkgvilvkdai
00495771   1/1  -----igvdvvlvsakk..galldilldilkgktvalvGpsGvGKStLlNaLlgellattgeipgdggdg
00410531   1/1  -------------------gelknlslelkkglkillvGlngvGKTtllkrlag................
00516041   1/1  ---------------------------mlk.gklillvGppGsGKtTlaralaeel....glpfvvidad
00477561   1/1  -----------------------------kkpkvillvGppGsGKtTlaraLakrlaelgkgvvvidtdd
00497571   1/1  ---------------------aselvqwlldlgildeseilledlenalalllsligaklvkdllllvlk
00462581   1/1  edleslllnplvkfedivpkvlddleealealaeaklpppkgvllyGppGtGKTtlaralakel......
00482661   1/1  -----kkvaivllsnyalsislddlllildlykevqvaydnfykvdesdiayqyallakedenaaaflks
00474201   1/1  -----deelelleklslllveklrpvllddlv.gqeeakeallealr.agrpghvllvGppGtGKTtlar
00463151   1/1  --------------------------------MkiIgltGpiGsGKsTvaklLaekl....glpvidtgD
00409841   1/1  ------------------------lslelkkglkvalvGrpgvGKSTLlnaLlga...............
00480501   1/1  -------------------------------MgklillvGppGsGKtTlaralaell...ggvvvidgdd
00488571   1/1  ----------------------------------------------------------------------
00486921   1/1  --------------------------------mlivltGppGsGKtTlakaLaerl....glpfistddl
00477721   1/1  ------------------------------kpklilltGppGsGKttlaraLaeelglpf..idtddllr
00512061   1/1  -------------------------------kkkkgklivltGppGsGKtTlakaLaerl...gglvvid
00509891   1/1  -------------------------------pkvigitGpsGsGKTTlanaLarllkarglkvavidrdp
00401211   1/1  ---------------------------elkrglnvgivGhvgaGKSTLlnaLlgll..............
00515801   1/1  --------------------------------llIvltGppGsGKtTlaklLaerlglpfistddllrea
00471271   1/1  ---prailelesliksllekllellkrlslklkkglkvalvGrpgvGKStLlnallggdfaevgptpgtT
00476651   1/1  -----yeplveklrpvllddlv.gqeeakeallealaggrpprpvllvGppGtGKTtlaralanelgrpf
00478131   1/1  -------------------------------kgkvivltGppGsGKtTlarlLaellkplglgvvvidg.
00493981   1/1  -------------------------------kpklilltGppGsGKttlaraLaeel....glpfidadd
00410321   1/1  ---------------yggllllkdlslelkkglkilllGlngaGKTTllnrllg----------------
00479331   1/1  -------------------------------apkli.ltGppGsGKttlakaLaeel....glpfidtdd
00420081   1/1  -----------------------------------smkkglrIaleGpsGvGKTTlaklLarhlgpt---
00501941   1/1  --------------------------------klilltGppGsGKttlaralaeel....glpfidaddl
00483811   1/1  -------------------------------PkvillsGpPGvGKTtlaaaLakyLksqgldvlvldlde
00486891   1/1  --------------------------------mlivltGppGsGKtTlakaLaerlglpvidtddllrel
00441251   1/1  -------lkyqgvefigflealknilkgipkknclllyGPpgtGKstlakalagllggtvlsv-------
00464591   1/1  --------------------------------klivltGppGsGKtTlakaLaerlglpfistddllrea
00491901   1/1  ------------------------------lmkgkiilltGppGsGKttlakaLaeelglpfidtddllr
00378621   1/1  ----------------glklllrrlslllkkglkvllvGlpgvGKstllnrlag----------------
00490531   1/1  ------tlpaleseardltekarpvllddviGqeeaierllealergppgnvLlvGppGtGKTtlarala
00518511   1/1  --------------------------------klIvleGpsGsGKsTlaklLa-----------------
00493061   1/1  --------------------------------mlIvltGppGsGKtTlakaLa-----------------
00459701   1/1  -------------------------------MpkvillvGppGsGKTTlakaL-----------------
00363171   1/1  --ikplklispfeprpyQqeaiealleglekgkknvllvgptGtGKTltaaal-----------------
00494911   1/1  -----llveklrpvllddlv.gqeeakealleala.agrpghvllvGppGtGKTtlaralanellrlgvl
00402381   1/1  ------PlsklleddlplllklrpdlfddvvgqdeaieallealrrarkglnlglkprgnvlLvGppGtG
00464421   1/1  -----------------------------MkkgkfIvieGpdGsGKTTlaklL-----------------


                         -         -         *         -         -         -         -:140
query           NDVPANKRQVNTVFQDYALFQHLNVYDNIAFGLKIKKVPADKIKEKVTEALRMVRLDGYEDRAISEMSGG
00378981   1/1  lllslaelllllrrgigyvfqdpalfpgltvrenlalglllaglskaeaaaraaellellglddlldrlv
00420701   1/1  llllslaellalrrgigyvfqdpalfpgltvrenlalglllaglskaeararalellellglddlldrlv
00425571   1/1  lalsllrrrigyvfqdpalfpgltvrenlalgllllglskaeaaaralellellglddlldrlvgeLSgG
00485451   1/1  tggkvlvigldifrlsarelrkrigvfqdpallphltvpenldlglll......eilervlellelvgld
00379581   1/1  talslaelrrrgigyvfqdpalfpgltvrenlalglllllllllllllllllalskaearervlellelv
00500441   1/1  sGeilldgkdildlsllrrgigyvfqdpalfpgltvlenlllgllllglslaeaaeralelllllgledl
00390411   1/1  irrgadkasvelvfeldggllallrllslsggeklrvalakallgnpeillngepvnhldlrelllnllr
00422801   1/1  lagllkptsGeilldgldilalslaelrrrigyvfqdpalfp.ltvrenlalglllallllglskaeara
00495371   1/1  dgldltglsparggiglvfqteallppltvrenlealgldlrglld...rerviellelvgleelldrlp
00490801   1/1  vGpnGsGKSTLlkllagllkptsGeilidgkditglspqelrrlgglvlqdvllffltll........ll
00510251   1/1  alvGpnGsGKSTLlkllagllkptsGeilidgkditglspqelrrlgglvlqdvllffltll........
00440861   1/1  StLlnaLlgllkpdegvilvggkgvTrdivlytledgvkltliDtpGlgdtklsdeeklilkyleeadlv
00361211   1/1  dgleisalslaerlragigyvfqdlalfpeltvlenlalg.............rarellerlglail.dr
00475891   1/1  sGeilldgkdilglsllellrrgigyvfqdpalfpgltvlenlllgllllglalkeaalralllllllgl
00482201   1/1  lglslkelrgigyvvqqdallpsltvlenlllgllllgllllllaakeaalralllllllgletlldrlp
00458601   1/1  tglspqelrrlggvvvqevllffltllenlllglallllllvlllllllllllllaakeaalrallllll
00502741   1/1  lglslaelrgigyvfqqlallpsltvlenlalgllllglskaeaaaraaellellgledlldrlpseLSg
00498251   1/1  tLalrllagllkpgggvvyidgeesldll.rarrlgvvlqelllfpeltveenl................
00482261   1/1  ldlslaelrgigyvfqqdallpsltvlenlllgllllgellllllaakeaalralllllllgletlldrl
00367901   1/1  dlilkgllllprstvatvelifdllgllliirrlilrdgsgeilidgkdislldlrelrrligyvpqdpa
00404101   1/1  talslaelrrgigyvfqdpalfpgltvrenlalgll.....kaeararalellellgldelldrlvgeLS
00509431   1/1  lsdliflgslirsgadrasvelvfdlsdglyllerselilrrlilkpgsgeilingkdislldlrelrrl
00475991   1/1  ptsGeilldgkdildlslaelrgigyvfqqdallpsltvlenlllglllagellllllaakeaalralll
00530591   1/1  gllkptsGeilldgkditdlslkelrgigyvvqqdallpsltvlenlllgllllgllllllaakeaalra
00436071   1/1  la...lrrgigyvfqdpalfpgltvlenlalgllllgll..ealaralellellglgdl.drlvseLSgG
00466971   1/1  lglslaelllllrrgigyvfqdpalfpgltvlenlllgllllglllllaakeaalrlellllllgletll
00466931   1/1  ilalspeellrllrrrigyvfqepalfpgltveenlllglllrlllelllgrlelllllllllellalll
00424961   1/1  dpdsgeilldgvdigersrevtelleelrrviglvfqdpplfprltvaenialgaeyfrdegadvlllad
00500611   1/1  illggkvlyisleeslrrrrigmvfqelgldpdltv.................arerviellelvgllel
00469451   1/1  kdvlylsleesleqlrrrigyvfqdpalfp.........................aeellelvgledlld
00468691   1/1  rvglvGpnGaGKttLlkllagllkpdsgeilvdGedlrelrelrrrigyvfqdpalfpeltvlenlalga
00372301   1/1  gilvdgedlr........igyvfq..................................llervgledlld
00488521   1/1  .............ggkvlyvdqeeslfp.ltvlenlalg...........gedveellerlgl.dlldrl
00496111   1/1  lelsaeelrerrrrigyvfqepalfpeltvlenlalgll..........................drlpg
00457311   1/1  dlyklsreelrklrrrigmvfqdpalflnpgltvrenlaeplrllklgkk........llepvglpevld
00495031   1/1  kvlyiglelt...lsperlrlraqsl...................gldldellerllvidllelvgllel
00436511   1/1  rvglvGpsGaGKtTLlkllagllkpdsGeilvdgligerlrevlelirelelaelrrrigyvfqdpalpa
00379601   1/1  l....lrnkigyvfQdpvlfp.ltvren..........................................
00367481   1/1  asggilvpgedalll..........................................rvdeiltrvglsd
00493431   1/1  eprpgevrgigyvfqsgalfphlivagnllegaevhgllygtskerveeale....kgllvlldrdlsgg
00532531   1/1  nleggfyakaigllrrkigyvfq...lfpfltvlenvalgld..glvdeedleraenllalvgleeipnr
00485931   1/1  .......rrigavpqlpvlfprltvlenlalg.......gadlaeraeellellglegfdvvliDtagrg
00448931   1/1  arla.areqlgivfqdp....gltvlenlalg.........eleararellellgledydvvliDtagrl
00503371   1/1  gpdsgeirldgkdlliylsdlirrgagiayveqefdlfdgltvlenvllglgdeliirrrilrdgrseyl
00422141   1/1  eeellallsrlkslaglpilearlpqggriqavlppvvvdfrvstlpdigglslvirklreviltledlg
00468601   1/1  yraaaaerlgigavpqdvplfpsltvldnlalardlleaa..kaagydvvlidtaglld.ldrlvgelsg
00437981   1/1  kdi......rrgiglvfqliglfphltvlelvalgl......ggilveevrellkel............l
00487021   1/1  llra.......gevfqdyalfphltvlelldnvllgleirgllkaerlervevllervgl..lldrippa
00478411   1/1  lvrlglkd.gigmvfqdpalfplltvrengvalglllaglskaeieervdlllelvglddlldrypdels
00475521   1/1  vdleplrrdigmvfqdpalfplltvrenvilgllelaglskaealarvdellelvglddellldrlp...
00381441   1/1  prlgevdgvdltfls..reeigyvfqepallpdltvlenlylglllalllaleegkivildgdreraeel
00371631   1/1  llgklalddvslsvkkpeiigiaGpsGsGKSTlarlLagllapesgglkvlligtDifylpaeqlkrigl
00477971   1/1  pprpgevdgvgyvfqsrelfpeltvagnflegaevrgnlygtsrerveellea.gldvlldidpqglsgg
00475371   1/1  rrpsarellg......................................llgellgldvlvgarggdlsgg
00368501   1/1  alakllga..pfiridgseltekdyvGesvearlrelfeeaigyvfqdpalfpg.tvlenlalgllvsel
00464791   1/1  kGervglvGpnGaGKTtLlkllagllkpdsgeivvyg.ligerprevrellglllelgvlf.........
00533501   1/1  pigtp..lgrgigyvfqdpalfpgltvrenlelllvfadrygvlrglikpalaegvsvildrvglsdlay
00478441   1/1  lvllelrgrdilmvfqppalfpllevrglniaevlelaglskaealkrvdlvlelvgld...drypyels
00462761   1/1  dlr....lglliglvfqdpdllpfltvlenvllpllaagliv.....ivdgtlllvglrealrkllglls
00464411   1/1  vsgeplge.ligevfqdgilfpdltvlenvalgrygllglikealaegvivildrvglsdla..ypgfls
00414121   1/1  ilidgqlledlgvlavrlgigyvpqtlglfpaltvlellalall.....................lredp
00496571   1/1  irgeplgelirglvfqdpllldeltvlenlalgrylhlglilaalaagvgvvldrvglsdlaygfprtls
00426051   1/1  vdlggesglllrdlrrliglvfqdpilfpgltvglllffldnidlgllirgdeeleaalelaglprviel
00475381   1/1  lavlsrdllgllreglirigyvfqdyalfprltvlenvllgll........................llg
00480471   1/1  geilldgkdltlvdtpgiargrlklllearraaigivfqdvdllltltvaenlllgldllllellkelky
00468951   1/1  LDlllgiGglprGelvlivGppGsGKTtlalqlaanlaklggkvlyidteesldqlr.arrlgldlddll
00515531   1/1  eidgvklqlwDtgGqerfrslwilyfedadaiifvvdlsdrdsflelrrwigrlfqdlnlfpsltvlenl
00437941   1/1  gvrvlgidaselld........................................................
00387201   1/1  lvreyelGeilldgrdlyrlsleeallllfldeileidglllvelregigyvfqdp--------------
00379961   1/1  lsdlldpkdlrellragiplvflnfaalpasllesel.................................
00510561   1/1  llgiGglprGelvliaGppGsGKTtlalqlaanlaaqggkvlyisteesleqlrarrlgldldrllllda
00470731   1/1  idgddlrekavgeleklgrdlfqvaregglvpdilfideidall.........rkgpdvildgagrtpeq
00512891   1/1  ...rsarrgigyvfq........tveellgllaelvgle............vrgeleellktlikelsgg
00503741   1/1  tLakllagllkpkfgeillfgkvvyvnvselldlkellrll.............................
00515511   1/1  eidgvklqlwDtgGqerfrslwllyfegadaiifvvdlsdgdsllalrrwigrlfqslnllesllvlenl
00379261   1/1  alAkllgapfvevdaselteggyvgedlekrirelfqearllvfltvlenirldaseylekrvvsrliga
00480441   1/1  trepregevlgvdyvfvdrelfeelivagnlledaivhgllygtskerieealda.glgvlldgfprgls
00498811   1/1  dltrelvaggglliglifqdfglfelldrellielllenlalglalegvildalrrrllelldllgldvv
00489571   1/1  ......................................................................
00490731   1/1  ..............yrpaadellgvlaee........................lgldvllgarggdlsgg
00532471   1/1  dvgelggaalldivdegrliglvfqdldllpllevlellaa.......................rleell
00498531   1/1  llgiGglprGsltliaGppGsGKTtlalqlaanlaklggkvlyisteesleqlrarrlgldldellllpa
00356411   1/1  dgvkltlwDtgGqesfrklwilyfegadaiifvvdasdrdsflnldkwrnrlgevlqllelilnltvlen
00434401   1/1  fyrpaaelllreglgidfqlpdal.....................drellreevlellglgevvivdvyd
00392701   1/1  agllgapfgrvdasd.......................................................
00499331   1/1  llrepvigagtdigevfqdlllaggllvddev..............rrlllealdelllaggkvvildgf
00406781   1/1  ..........................................................llgkyvgelsgg
00484101   1/1  grldldellgigylfqdvgllpvltvrenlalllrglpgysaeeleralellelagfdvilieGllelal
00368571   1/1  geyaglarglgvvildpgdgrsvrlnplaliddeedaaellralvsemgrgeddfftpaarallralila
00404191   1/1  vsa..............................................................delvs
00508671   1/1  gvvlldgddlraglsiglilsdedraalrrrlgevfqelllagrlvvldgtalglelrdelrellkeagl
00420941   1/1  ........................................................sellgkyvgelsgg
00499191   1/1  ......gllvgvvfqddfylllpalevlengaflldlllpdaldrelllelllalveglvvlldryprll
00444381   1/1  vlLvGppGtGKTtlakalakllg...............................................
00477011   1/1  telrlsetpgltvlvvflelgerldllglvfqdfsllpelielenralagpiagisrdairleielpglp
00533151   1/1  llrelvpggldigevfqda.leaglllfddefrglller.....leellarg.pvvildgf........p
00489631   1/1  llrellgellgrgigfgfqqgdlledatvlenlalllldeidka...................ledggvv
00451571   1/1  .....lreaiglvtqdgelllelid.egilvpdeiv.......iellrealeeldadgvildgfprllgq
00515351   1/1  eav......pggtdigelfqdyllfpfltvdeni..............rglllealeellaag.kvvild
00437901   1/1  lakalakelgapv..ieidaselrd.............................................
00480251   1/1  pyr..............psapeqlgilgellgvpvvgvltgldlagalrealellllegy.dvvliDtag
00405881   1/1  nlgvvelddgrqlvlvDtpGlielaslgeglvrqalealeradvillvvdasdplld.....qpvellsg
00482551   1/1  laanaalplelgklggkvlyisteeafsperlreralsl..........................gldle
00394721   1/1  akelaagsgpilldgvpv....................................................
00513761   1/1  aranlpeqlgidirdl....idletvmelglgpngalvfa............leellttldillealell
00367291   1/1  ...............................................................pfirvda
00386741   1/1  ..............................................................pfvrlda.
00521551   1/1  agllga.............................................................pfv
00472911   1/1  lageggkpl.....................................................gllfedal
00496061   1/1  ....evepggtdlgeifqalllagel.lfddevlgll.........rerldelielllaggvvildgfpl
00432181   1/1  tlgvveldgrkl...................................................vliDtpG
00439861   1/1  alqlaanlaknggkvlyisleesreqlleraerlgldleellllgllsiliad.................
00473941   1/1  ..............................................................pfielsas
00513251   1/1  r....................................................................g
00402371   1/1  alagllvrssgpilldgvpf..................................................
00437921   1/1  laralarlllgsgggvdvieldasdlrgvddlreligevlqalglllgg.....................
00527261   1/1  akel..gkpviyidlselsskgyvdleellrelaeelgell......................ellkkll
00457851   1/1  ......avpggtrlgeviqdlfllggllffdeldel..........lkerieellaag..gvildgfpld
00457881   1/1  e......pdgtelgellqdlllaggl.lpdaivrdlllel......leelladgkgvildgf....prdl
00486581   1/1  ----------------------------------------------------------------------
00469161   1/1  fgtplgelirelllegfqdlilvpdllvlellaan......ragl.relikellaagkgvildrfplsrl
00519581   1/1  l........fgdvgglvvdli...............................................dl
00478391   1/1  llrelvgeggrlgrdlfdedrllfrellideidl....................................
00489391   1/1  lreavpggtdlgelfqdlllegellfideiaelllealae..............................
00476071   1/1  vll.ggpllerirellgegyllfdealdrellaallfglelegal........................l
00430121   1/1  KTtlakalagllfp........................................................
00478081   1/1  lrreairelllgldlleilf..........................................eglllsde
00461621   1/1  ..revvergtelgklikdyfdpgalvpdllirlllerllfldegggflldgfp.rtleqaeals......
00487061   1/1  yepvdywaavgggdllrlirelllrlgfgepdafdnellgellealleg.....................
00418301   1/1  alakllgr..............................................................
00482721   1/1  .vaggtplgerirellgegyllpdea......lfrallaellfgdll..alalldgvvydrlrdellael
00493171   1/1  repregevdgvdyvfvsgelfkelidagelledaivigllyergtlldavegalld.........gfpvl
00517691   1/1  ..........................................gtlllllgllsfllalvldslplererg
00416171   1/1  lte...............................................dlleselfgh...ekgafgg
00511381   1/1  dtrlgielvvsriglvleavglffaldllelll.....................................
00495771   1/1  rhtTrdvllirle.glvliDtpGfrdti.len--------------------------------------
00410531   1/1  ...................................gefv..dygptigvnfktvevdg.vklviwDtaGq
00516041   1/1  dllrgeelgriielfdearelvpelallfideidell...............akgkvvild.........
00477561   1/1  lrr............................................alifqdeldlfdedree..gfrv
00497571   1/1  ylpsllslldvlrpkvdfddiileeakeelllellelplklpelfkrlglkapkrrgvlLyGppGtGKTl
00462581   1/1  ....glpfvrinasd..................................................llvgl
00482661   1/1  nrqkklvrdladrviaeerlellekiieellrirldklledldeiveelppvlfddlvgqeeakeallen
00474201   1/1  alanelprslpgl.........................................................
00463151   1/1  ilrkalyratglgalakiisliellilfgelvpddlvldrlvlerlvf......sdpee.vildg.phpl
00409841   1/1  ............................................................dlaivsdipg
00480501   1/1  lrralvggl............................................idgllilfledeaalse
00488571   1/1  ----------------------------------------------------------------------
00486921   1/1  lreavpggtd.lgelfqelllegellfrdell..............dlllevieellaag..gvildgfp
00477721   1/1  elvgegielilelfd.......................................................
00512061   1/1  tddllrea....................................gkirelfgflgelvfralelglllde
00509891   1/1  grld..........................ldeplgv...drerlrrvgelalllaggglcalvaddlag
00401211   1/1  ...........................................................ldtlkgelerg
00515801   1/1  vpggtpl.....geeirdlldagellpdeelr......................................
00471271   1/1  rdikvvtvegkgvklt------------------------------------------------------
00476651   1/1  vpvallcfvrvncaallelsasdll.............................................
00478131   1/1  .................................................ddlrreavgqlglglsieeld
00493981   1/1  llr.elvgegigllfelaeraeflillideidkllee.................................
00410321   1/1  ----------------------------------------------------------------------
00479331   1/1  llrklv...............................gesirellelagelaprillldeilellekggi
00420081   1/1  ----------------------------------------------------------------------
00501941   1/1  lrelv................................................................g
00483811   1/1  llrgllgqpk............................................................
00486891   1/1  eidgtplg......eeirdlllagellfraevrdll..................................
00441251   1/1  ----------------------------------------------------------------------
00464591   1/1  vlggtplg......eeirdlleagallpda----------------------------------------
00491901   1/1  ea..klggelaeliedlfv.......................prellidlikellka.............
00378621   1/1  ----------------------------------------------------------------------
00490531   1/1  kelargd.....................................................vpevlvgvpv
00518511   1/1  ----------------------------------------------------------------------
00493061   1/1  ----------------------------------------------------------------------
00459701   1/1  ----------------------------------------------------------------------
00363171   1/1  ----------------------------------------------------------------------
00494911   1/1  glpf...............................................................vrv
00402381   1/1  KTtlaralakalg.........................................................
00464421   1/1  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           QRQRVAIARAIVLDPKVLLLDEPLSALDQKLRAEMQYELRSLQKKLGITFIFITHDQEEALAMSDEIFVL
00378981   1/1  geLSgGqrqrvalarallldpdllllDEptsgLDpetraellellrelakelgltvllvthdlsealrla
00420701   1/1  geLSgGqrqrvalarallldpdllllDEptsgLDpetraellellrelakelgltvllvthdlsealrla
00425571   1/1  qrqrvalarallldpdllllDEptsgLDpetraellellrelakelgltvllvthdlsealaladrilvl
00485451   1/1  vvlldtyphelSgGqrqRvaiaralaldpdvlllDEptsglDpetralelldllrtdldkelgrtiilvt
00379581   1/1  gldtlldrlvgeLSgGqrqrvalarallldpdllllDEptsgLDpetraellellrelake.gltvllvt
00500441   1/1  ldrlvseLSgGqrqrvalarallldpdllllDEPtsgLDpetraellellrelakelgltvllvthdlse
00390411   1/1  rrgiglvpqehdlfplltvaenialldelaglpkygnylsllkeklkelnallkelelqlkelarllell
00422801   1/1  ralellellplgldtlldrlvgeLSgGqrqrvalArallldpdllllDEptsgLDpetraellellrela
00495371   1/1  relsggnqrqrvvia.alallpkllllDEptsaldvslraeilrlLkrlakelgvtvllvthdleeveel
00490801   1/1  laakeaalralllllllgletlldrrpseLSgGqrqRvalArallldpdlllLDEPtsgLDpetraelle
00510251   1/1  lllaakeaalraellllllgletlldrrpseLSgGqrqRvalArallldpdllllDEPtsgLDpetrael
00440861   1/1  llviddglteldlellkllkelgkpvilvlnkiDllkkeelekllkslnkelglkelrrgigyvfqdpnl
00361211   1/1  lpgeLSgGqqqrvaiaralaldpdllllDeptsalssrssendpetvaellellkelakelgvtvilvth
00475891   1/1  etlldrlvseLSgGqrqrvalarallldpkllllDEPtsgLDpetraellellrelake.gltvllvthd
00482201   1/1  seLSgGqrqrvalArallldpkllllDEPtsgLDpetraellellrelak..gltvllvthdlsea.rla
00458601   1/1  lgledlldrlpseLSgGqrqrvalArallldpdllllDEPtsgLDpetraellellrelake.gltvllv
00502741   1/1  GqrqrvalArallldpdllllDEPtsgLDpetraellellrelake.gltvllvthdldealrladrilv
00498251   1/1  ...............drlprllsggqrqrvvidsalalrpkllllDEPtsgldplsarellellrrllrl
00482261   1/1  pseLSgGqrqrvalArallldpdllllDEPtsgLDpetraellellrelak..gltvllvthdlseal.l
00367901   1/1  lfpqltvlenlllglelrrklldellgllellalleellklleellkelevleaalaallkeeieeraee
00404101   1/1  gGqrqrvalarallllleelsldpdllllDEPtsglDpetraellellrelake.gltvllvthdldeal
00509431   1/1  igyvpqdpnllfqltvlenlllgpeerrelldellglellsleealaraeealeelnallkeleeeleli
00475991   1/1  llllgletlldrlpseLSgGqrqrvalArallldpdllllDEPtsgLDpetraellellrelake.gltv
00530591   1/1  lllllllgletlldrlpseLSgGqrqrvalArallldpkllllDEPtsgLDpetraellellrelak..g
00436071   1/1  qrqrvalarallldpdllllDEptsglDpetralllellrelaeelgltvllvthdldlalaladrivvl
00466971   1/1  drlvseLSgGqrqrvalarallldpdllllDEPtsgLDpetraellellrelake.gltvllvthdldea
00466931   1/1  dlllllllllllllllllllvlllllllllvlllllllalllllalkeaallleelllllglgdlldrpv
00424961   1/1  sllrlagalrevlgrlgrelSgGqkqrvaiarallleragnleggGsiTalatvlveggsdpdllllDep
00500611   1/1  ldrlprelkrsggqrqrvviDaralllrpe.l.lDEptsaldvslraeilrlLkrlakelgvtvllvthd
00469451   1/1  rlpgelSgGqrq..aiara.ardpdllllDeptsalrgsenDpetraeilrlLkelakelgvtvilvtH.
00468691   1/1  llag................lglaeyldelgkdLSgGqrqrvalAr.....pvlLllDEptsgldalre.
00372301   1/1  rlpstlsgGqrqrvai.ralatepsllLlDEptsgldpelraalaeallellaelgatvlfvtHdlelaa
00488521   1/1  phqlsggqrqrvaiaralaeelkpdllvlDeitalfraelegrptsaldvsllrellrlLkrlakelgvt
00496111   1/1  eldlSgglqrqrvaia...agdpdllllDeptsalrslgndpelraellrllkrl.kelgvtvilvthdl
00457311   1/1  ryphelsgGqrQRv...ralaldpdllilDeptsalgqpdpelr.elldllifldadlgltlirlitrdl
00495031   1/1  ldrlprelsggqrqrvviDalalllrpell..DeptsaldvqlvaeilrlLkrlakelgvtvilvthdlr
00436511   1/1  llrllalfpaltvaenlrfglglavlllldsatrlaqakreisalarellervglpgdlftllsr-----
00379601   1/1  ......laralrqdPdilllDEptsalda....ellqallt.....ghtvvlvthhlntaldladriivl
00367481   1/1  lldrgls.lsggerqrvalaralatdpslllLDEptsgldpedgaalaeallellaellgatvlvvtHdl
00493431   1/1  qqlrvalaralvvfildpslelldeRlsgrdadtreeirkrlkrlleelgplieydyvivnddleealee
00532531   1/1  ypselsgGqqqrv...........illldEPtsgLdpvsr............................le
00485931   1/1  rrvgelsggqkqrvaiarallllldpelllldEptsglda......lrlllellkelgltvlvvthddgt
00448931   1/1  rlpselsggqkqrvaiaralaaplppevllldeptsglda......lrellellrelgltvlvvthlDll
00503371   1/1  lnglgvs...lkeliellldlsggelnrvalllqgevdlllldepterldfldelagleeykgnyeellk
00422141   1/1  lsy.gdpealkdlslaippgglvlltGptGsGKtTllralagllnpdegriltiedp..........iey
00468601   1/1  gqkqrvaiarala.apevllldeptsglda......laellelleelgltvlvvtKlDgtakgghdlsla
00437981   1/1  sgGqkqrvaiaralagdpkvlllDEpt.aldpdaqnaLlklleelak..gvtvilathdlsellpallsr
00487021   1/1  lsgGqgqrvildrallselayqpdvllldeplsgldaklreelrdllrellpe.gilpdlvifldadpee
00478411   1/1  ggqrqrvaiaralalepelllldeptsaldplavvellelllglneeldiilalelllld----------
00475521   1/1  sggqqqeilrvaiallilpvllgralallpelllldeptsaldpd-------------------------
00381441   1/1  lellgldadlviilpasleellerldrrggelsggqkqRvala---------------------------
00371631   1/1  lfqkglpealdveellellldlke....................gledilvpvlsggqkqrlalaralve
00477971   1/1  qkqrlalaralilppsllrgldep.ealdarle.raleellelae..gfdvvivnhdleealelldril-
00475371   1/1  lrqr..larallgdpdvlliDepgrgldpellallaelldllrelradlgllvvdathdldavlkaadri
00368501   1/1  igappgyvggdlggllteavlealriklvegelgfrelerevlldlplhdasviallgggrelrdgellk
00464791   1/1  ................aaellervglvaatadeppgelsggqrqrlaiAraladdqgkpvllllDEptsg
00533501   1/1  dgfprllsgggrqrvalaralvvkpdlvilldeplevldeRlrkrgrlelrelds.eevlekrlehylel
00478441   1/1  ggerqrvailr..vllpklllpdepgrnldvlievavlnlilkl...lgidallelvdr-----------
00462761   1/1  gGqkqrvadlvvlldadpevllaReptrgldpeteeeleellerleereplygadiviithdls.ieeva
00464411   1/1  ggeqqrvaiarallpkpdlvllldepteeldeRllkRg....rllek.leyikkrlehylelaepykddv
00414121   1/1  dlilid.sgGqkqrlalaralladpdlgellllDeptlvlDaasgedlldllkelaeqlgltvlivlnKi
00496571   1/1  glgqrqrvalarallkpdlvifldeppteeldeRlrkrl.........rlgdteevlehrleraeeladr
00426051   1/1  llegldtlaggggvvlsGgqrqrvalar.....pdlllfldeptselleRllkrltrpgldadteeelle
00475381   1/1  glvvildggvrqrlalarallldpdvllldeplllldaalr............dlpdlvifl--------
00480471   1/1  dpvilllnkidllddrllrraeaeerie------------------------------------------
00468951   1/1  llpaltveellala...............................erllsggkpqlvviDsltalrpall
00515531   1/1  anvpillvlnKiDlleakeraeellellglgdlldklpselsgGqkqrv---------------------
00437941   1/1  ..pselsggerqrvliaralladpkvlllDEi.daldpeaqnaLlklleelpk..gvtvilttnrleeld
00387201   1/1  ----------------------------------------------------------------------
00379961   1/1  ....lsggerqrvalaralalrpGllvlAdggvlllDEp.daldpevqaaLlrlleegevtieragitll
00510561   1/1  ltv...............................eellalaerllsggkvdlvviDsltalapalelsll
00470731   1/1  lealldlleelgrpvvviilttnrevlldral.rRpgrllldep..eldppdreerleilkrllkklg.t
00512891   1/1  ekqrvalarallakpdvlllDEid.gldpdvleallelleelk.rsgvtvilttndldel.eladriall
00503741   1/1  .........lealglpppyqlsggerlrvalaeallalgkpdllilDEitnlldpetlspdvlelLlrll
00515511   1/1  anvpillvlnKiDlleaklvllllvglfdlldglpselsggqkqr-------------------------
00379261   1/1  ppgyvgyglggllteavrrlpysvllldelekahrpirvlllsaslvlllgglglpevgelllellddvg
00480441   1/1  qaqalrlaldlvllldpslevlleRllgrgddteevirkrlerlapeleyyeelgladvvivnddleeal
00498811   1/1  ilegplllsgglrqrpdlvifldappevlleRllkRggldeetiekrlelylelaplygaadividnd.l
00489571   1/1  ..lallelrntteagaasgsrdkgllgklkpetraelldllre..egttilvvth...ldeaer.aDrva
00490731   1/1  lrqr..larallgdydvliiDtp.gtldvllelallellkellaelgadvvllvvdatlgleaadrilvl
00532471   1/1  erippalsggqgqrvildrslysrpavlllllyvdeplsgldvelreelrdlleslllvlplpdlviyld
00498531   1/1  ltveellala...............................erllsggkpdlvviDsltalapsllllde
00356411   1/1  vpiilvlNKiDlleekive.ellellgleykgdrdpeelsggqkqrvalarala----------------
00434401   1/1  lsggerqr...aralasgpdvlilDgptlgldv.............lldlpdlvifvdhdlevalerrlk
00392701   1/1  ......llgkyvgelsgglrqr..larallakpsvlllDEidklapkrsptsgldvelrrrvlnaLlrll
00499331   1/1  pggllqrealrrllprpdlvilldappeelleRllkrgrldgreddslellekrleryeeltrdlielye
00406781   1/1  lrqrlalara..adpgvlllDEidalldarsgsgsggdsssrrvlnaLlrlleelrllsgvtviattndl
00484101   1/1  plilelrelsdgqiqrvaparallrdpllllldedtvvldkvdlasildllle-----------------
00368571   1/1  laeepeptldellellselg...............lrdladrleklvagglagllegaektaasilellr
00404191   1/1  klsgglqeqrvaiafalarkpdllllDEidalgldpelqeellelldelaer.gvtlilttnnrpeeldq
00508671   1/1  pll.vvfldaplevlleRdrrglypeelsgglkqrvaiarplelaaepdlv-------------------
00420941   1/1  lrqllalara..akpsilllDEidklapkrsptsaldadvrrevlnaLlrlldglqalsnvtviattnrp
00499191   1/1  sggqrqrvaia.....dpdvlildgptllldpe...........lrpladlv.ifldaspee--------
00444381   1/1  ................vpfiridgselte.kelvGesegailsggfkqrvgia..lladpgilflDEidk
00477011   1/1  dltlvDtPGlgsvavvdqlsggqkqrvalarallknpdtlillvedandldtesd---------------
00533151   1/1  ggllqrealrrlllrpdlvifldapleelleRllkrgrlirleddseevlekrlerylklyerliepyee
00489631   1/1  lldgfdrsqlqrlailrallddppdlvvfldapleellerllkRdgrteeeilerlarleeryradlviv
00451571   1/1  aelllsggkadlvifldaplevlleRllkrddekilkrleeqkqrvaiarallk----------------
00515351   1/1  glsggllqrvallrallrpdlvifldapleelleRllkR..............................d
00437901   1/1  .........vddlsgyvgelsggeklrellaealteavlkgkpsvlllDEi.daldpd------------
00480251   1/1  glqrglllalaladlllvllldepllvldatagtellelakgllealgldgvvltkldlvaalgaalsva
00405881   1/1  gekqrlalarallgkpvilvlNKiDep....tneldlellellee....lggtvvlvSahdgegldelld
00482551   1/1  elldrllvidatdlldllellerlrrllsegkvdlvviDslallarael..ldepllgldarelrellrl
00394721   1/1  .vrldlsellsvsdlvgelegglrgllteala..lakpsvlflDEidrlldardsess------------
00513761   1/1  eedydyiliDtpGglelrallalllaiaralaadeillvddptsgldaetqleilelllelllklgi---
00367291   1/1  selleklvgegegrlrgalaealradpgvlflDEidalagkrgsgtsrldpevqnaLlr-----------
00386741   1/1  .....selsggeklrgllarala.kpgvlllDEida.ldpdvqeallelleegeltivg-----------
00521551   1/1  rlsaselvgkyvgelegglrqllalaraa..npgvlflDEidklapkrsptsglddvsr-----------
00472911   1/1  eagfrqrladlirallakgkvvild..gtglsreareellellkelg...pvlvifldadpe--------
00496061   1/1  dlegalllrealarallpdl.vifldapleelleRllkr...............................
00432181   1/1  leefa....sggekqrvalalallreadvlllvvdadeptsfldle....lle-----------------
00439861   1/1  .................plglsgeellrvllalalelkpdlliiDeltalldaervrelrellralkrla
00473941   1/1  dllgesdlrggfkqa........akpgvlflDEidrl.drevqnaLlelleelqvtilg-----------
00513251   1/1  qkqrvalleaalkegylvvvDet..gldraqrlellelardlgrpv.lviflatspevlierlldrvlll
00402371   1/1  ...vrldasellefgkyvgafegglrqllglaraa..kpgvlflDEidsllgarggsgvdpevqnaLlrl
00437921   1/1  .......................................kpdvlllDEi.drldpdaq------------
00527261   1/1  kklsellglsilglelilglsggdleelleelaellkklgkpvililDEiqslld.--------------
00457851   1/1  legaealreallragplpdlvifldapleelleRllkrgr.eplddteevilkrlerlrelyerliepye
00457881   1/1  eqaealrallaelglppdlvifldaplevlleRllkrgddpeealekrlklyepllelyeea.....dyl
00486581   1/1  ----------------------------------------------------------------------
00469161   1/1  ayqlsggerqrlaidlegalllerllldep......................fpdlviflda--------
00519581   1/1  eaverhlldiaeellengeilildeptvgldsk...dildelakilkevnfelifithdedelrerialr
00478391   1/1  .............llakgkvvildgtnlsealdealrrllr..........pdlvifldapl--------
00489391   1/1  .............aegkvvildgtg..ldieqrealrelllel..prpdlvifldadpeell--------
00476071   1/1  dglvygvlqdrllerllaagpdvlildgpl.lldvell...........plpdlv.ifldap--------
00430121   1/1  ....sgvpfirinlseltekllvselighppg..yvGedelgvlfeaarkappsvlllDE.idkldpd--
00478081   1/1  frelleealalladgdvvilDgfgrlldarq...lleelllllleepppdlvifldadpevlleRllk--
00461621   1/1  .kpavlsggrkqrlalaralavdpe.lildgrllgr..rllplpd............lvif---------
00487061   1/1  ....................gki.vlsarraqlleirlirpllaegkvvilDrepdsadlafa-------
00418301   1/1  .pfirvdaselte...aelvGyesgarlrelfaragigllaladpgvlflDEidk---------------
00482721   1/1  sggqgdvliiegalllepgllplpdlvifldappevlleRllkRggdseeeiekrleryreiaplleaad
00493171   1/1  ldgalqlllllrelllkpdlvilldvslevlleRllkRgrdseevikkrleryleetplidyydlvivnd
00517691   1/1  itidvalarllldgrkilllDtP-----------------------------------------------
00416171   1/1  gekqrlgllrla..dggvlflDEidkl.....dpdvqnaLlrvleegeltrlgggivlpadvrliaa---
00511381   1/1  ...............qdpdviliDE.aqfldp....evvevllelad.tgilvlvtglemdfagelfegs
00495771   1/1  ----------------------------------------------------------------------
00410531   1/1  erfrsllarylrgadgillvvdatdglsfeevaklleellglaglegvpiilvgn---------------
00516041   1/1  .gtgrlleldealellgpdlvifldappeelleRllkr............gldeeaieerlerlreilep
00477561   1/1  peelvrellkel.larllaeggdvvilDgt......nltleqrealrrllkelgrpdlviyld-------
00497571   1/1  lakalakelgrl.pfirvn...................................................
00462581   1/1  lvgelegrlrglfteav..lanpgvlflDE.idrlplkrqaggdllrallealltlldg-----------
00482661   1/1  lklflkgpellldlglpkgrgllLyGPpGtGKTtlakalanel...ggpvi.......------------
00474201   1/1  ......pfvrvnasdltdvglleellgkllgaatfllakpgvlflDE.idkl....dp------------
00463151   1/1  vqaeild.....eiaralsvvldllvldeplvglqrrl..agrrgivadgrdigtvvfpdaelvklllea
00409841   1/1  ttrdpilgvvlldgrdllllDtPGlidfaseptnlldlei------------------------------
00480501   1/1  lvlevllealegggnpdvvildgt......nlleedrellrellkrlgrpdlvifldapleellerllkr
00488571   1/1  ----------------------------------------------------------------------
00486921   1/1  lslegaqalrallrelgldpdlvifldappevlleRllkr------------------------------
00477721   1/1  ........rarfrkllielldellaaggvvldlgrtlllrralrellreldl.vvfldaple--------
00512061   1/1  iekl...........lakgkvvildgtllgteqreal..............dlvifldaple--------
00509891   1/1  aleel.laralaggpdviliEgagllplp........liellrdlldlvvlvvld.givllvdaidrlea
00401211   1/1  itikigaasllldklaivsdtpg-----------------------------------------------
00515801   1/1  ...dlllevirellaag.gvildgfp......ldleqaealrallkelglrpdlvifldasp--------
00471271   1/1  ----------------------------------------------------------------------
00476651   1/1  ..........eselfge.ekeaflgallerlgklalagggtvlflDEidkl.....dpd-----------
00478131   1/1  ealllpdalrralleealealkagdvvildgfgrslaarq......lllellrelgrvvkpd--------
00493981   1/1  ...............gkvvildgtplllea.....lrellreld.....lvvfldappeell--------
00410321   1/1  ----------------------------------------------------------------------
00479331   1/1  vlddggrnllrallrellspdlvifldappevllerllrrgrldllvdeerleellkllekllplykeea
00420081   1/1  ----------------------------------------------------------------------
00501941   1/1  esirelfeaagrlaprellldeidellekggivildgflltlrellpepdlvvfldaslevl--------
00483811   1/1  ....lydlleellellldegekipveliiellkdvlvsdpdviilDelpgtnlklqdletls--------
00486891   1/1  ...........yelllealeag.gvvldgf......pldleqaellrellkelglppdlvif--------
00441251   1/1  ----------------------------------------------------------------------
00464591   1/1  ----------------------------------------------------------------------
00491901   1/1  ..................g.vvildgtnlgleqlral..............dlvifldaple--------
00378621   1/1  ----------------------------------------------------------------------
00490531   1/1  ieinassllfGskyvgefeeal------------------------------------------------
00518511   1/1  ----------------------------------------------------------------------
00493061   1/1  ----------------------------------------------------------------------
00459701   1/1  ----------------------------------------------------------------------
00363171   1/1  ----------------------------------------------------------------------
00494911   1/1  nasellealllsdlfgellgallralfellrgalelakggvlflDE.idrl....spdv-----------
00402381   1/1  ......vpfvrinlselteall------------------------------------------------
00464421   1/1  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           NNGNIVQSGTPVDIYDEPINHYVADFIGESNIVNGIMIKDELVEFAGQQFPCVDGGMKPNEPVEVVIRPE
00378981   1/1  drilvlddGrivelgtpeellenpasl-------------------------------------------
00420701   1/1  drilvlddGrivelgtpeellenpasly------------------------------------------
00425571   1/1  ddGrivelgtpeellenpaslytaellg------------------------------------------
00485451   1/1  hdlreae..adrilvlrkgdivelgepqellaepklp---------------------------------
00379581   1/1  hdldealrladrilvldd----------------------------------------------------
00500441   1/1  alrladrilvlddGrivelgtpeellenp-----------------------------------------
00390411   1/1  eglkeeaek-------------------------------------------------------------
00422801   1/1  k..gltvllvthd---------------------------------------------------------
00495371   1/1  adrvavlaggriveqgadvvlflrrde.........gglrelivvknrlgptgevvfei-----------
00490801   1/1  llrelake.gktvllvtHdlseal.ladrilvlddGriveegtpeellanp-------------------
00510251   1/1  lellrelake.gktvllvtHdlseal.ladrilvlddGriveegtpeellen------------------
00440861   1/1  fpglvvlisaltgegldeltvren----------------------------------------------
00361211   1/1  dldlldsallrpgkrpllsdlrgsgeieqlad--------------------------------------
00475891   1/1  ldealrladrilvlddGr----------------------------------------------------
00482201   1/1  drilvlddGrivelgtpeellenpgllytll---------------------------------------
00458601   1/1  tHdldealrladrilvlddGriveegtpeellenpl----------------------------------
00502741   1/1  lddGrivelgtpeellenpgllytllllgslp--------------------------------------
00498251   1/1  akelgvtvllvthdldeaealadrvlvlaggrilehgadtvlllrrdelyvagfeggg------------
00482261   1/1  adrilvlddGrivelgtpeellenpgllytll--------------------------------------
00367901   1/1  llellglgglldr---------------------------------------------------------
00404101   1/1  rladrilvlddGrivelgtpeellen--------------------------------------------
00509431   1/1  gplldglellvglnglldrplselSgGe------------------------------------------
00475991   1/1  llvtHdlsealrladril----------------------------------------------------
00530591   1/1  ltvllvtHdlseal.lad----------------------------------------------------
00436071   1/1  d---------------------------------------------------------------------
00466971   1/1  lrladrilvlddGr--------------------------------------------------------
00466931   1/1  stLSGGerqrval---------------------------------------------------------
00424961   1/1  tsalDgeivlslll--------------------------------------------------------
00500611   1/1  lreveeladkrdrvvvlrggriveqgadvvlflrrde.........ggvrelivvknrlgpt--------
00469451   1/1  .......Asdrvlvlrdgrivevgtpdelllkpllllvl-------------------------------
00468691   1/1  .ilellrellkelgytvllvthdls....la---------------------------------------
00372301   1/1  lladrvvvlndgrivavgtpeelyklpaglldr-------------------------------------
00488521   1/1  vllvthdldevarladrvlvlag-----------------------------------------------
00496111   1/1  eeaedladsgriavladgrivlegdlael-----------------------------------------
00457311   1/1  geagrsadrvl....griveqgppeelfinpqhp------------------------------------
00495031   1/1  evegrleladrvvvlrggrileqgadvvlflrrde.........ggvrelivvknrlgpt----------
00436511   1/1  ----------------------------------------------------------------------
00379601   1/1  ddGriveegtpeellanplasal-----------------------------------------------
00367481   1/1  elaalaadrivvl.n-------------------------------------------------------
00493431   1/1  lldiivvlllglilqpgslle-------------------------------------------------
00532531   1/1  ladriyvllsGrivesgtteelltepka------------------------------------------
00485931   1/1  akggaalslaleladril----------------------------------------------------
00448931   1/1  akggadlslaleladrilvlgdGe----------------------------------------------
00503371   1/1  lleeleellkelekrl------------------------------------------------------
00422141   1/1  vfqspnlfpl................--------------------------------------------
00468601   1/1  lrladrilvlgvGeived----------------------------------------------------
00437981   1/1  cqvirfpplseeelleil----------------------------------------------------
00487021   1/1  lleR.....llkRgresergepldlleevleky-------------------------------------
00478411   1/1  ----------------------------------------------------------------------
00475521   1/1  ----------------------------------------------------------------------
00381441   1/1  ----------------------------------------------------------------------
00371631   1/1  dpdvlilDgpta----------------------------------------------------------
00477971   1/1  ----------------------------------------------------------------------
00475371   1/1  lvldlggivlnkldlvakggaalela--------------------------------------------
00368501   1/1  alkeaeaeellellglkdlllrkpsql-------------------------------------------
00464791   1/1  ldal..reillllgellseegytv----------------------------------------------
00533501   1/1  lekad.rvvvidag.....gsleevveeile.--------------------------------------
00478441   1/1  ----------------------------------------------------------------------
00462761   1/1  drilall---------------------------------------------------------------
00464411   1/1  vvidan.....gsieevveei-------------------------------------------------
00414121   1/1  Dllselthdlellreladrilvlgdgriv-----------------------------------------
00496571   1/1  lialyegavvvidasglsleevveeilei-----------------------------------------
00426051   1/1  llerl-----------------------------------------------------------------
00475381   1/1  ----------------------------------------------------------------------
00480471   1/1  ----------------------------------------------------------------------
00468951   1/1  lldeptgellgldvrllsellr------------------------------------------------
00515531   1/1  ----------------------------------------------------------------------
00437941   1/1  pallsRfdviefpppd------------------------------------------------------
00387201   1/1  ----------------------------------------------------------------------
00379961   1/1  lpagvtviaatnddlgeldpal------------------------------------------------
00510561   1/1  ldeptsgldasllreilrllkrlak---------------------------------------------
00470731   1/1  vldvthddel.arladr......gtlvliaa---------------------------------------
00512891   1/1  rrgrivelgpl-----------------------------------------------------------
00503741   1/1  eegkltd---------------------------------------------------------------
00515511   1/1  ----------------------------------------------------------------------
00379261   1/1  ltdllgrtvdfkntiiiltsnvgelsg-------------------------------------------
00480441   1/1  elllailla-------------------------------------------------------------
00498811   1/1  sle-------------------------------------------------------------------
00489571   1/1  vldd......Gtpeellarpanpyvrellgavpgllllallllle-------------------------
00490731   1/1  leglgvpgvvlNkldlva----------------------------------------------------
00532471   1/1  adpeell...eRllkRgrdpeeqe..rld-----------------------------------------
00498531   1/1  pgrvtqgldarllreilrllkrlakelgitvl--------------------------------------
00356411   1/1  ----------------------------------------------------------------------
00434401   1/1  r---------------------------------------------------------------------
00392701   1/1  eglrllsgvtviattnrpeeldpal---------------------------------------------
00499331   1/1  eadrvividag.....lsieevvee.....il--------------------------------------
00406781   1/1  eel-------------------------------------------------------------------
00484101   1/1  ----------------------------------------------------------------------
00368571   1/1  kll-------------------------------------------------------------------
00404191   1/1  allrllsrldrvivldlppdleergeilkrlaek..lglplsdevl------------------------
00508671   1/1  ----------------------------------------------------------------------
00420941   1/1  eeldpallrpgRfdlviefplpdeeerleilkllleklglesde--------------------------
00499191   1/1  ----------------------------------------------------------------------
00444381   1/1  llddrgeaegggdvsregvqn-------------------------------------------------
00477011   1/1  ----------------------------------------------------------------------
00533151   1/1  addv------------------------------------------------------------------
00489631   1/1  tddl.......................-------------------------------------------
00451571   1/1  ----------------------------------------------------------------------
00515351   1/1  dseeeilerleryreelepl--------------------------------------------------
00437901   1/1  ----------------------------------------------------------------------
00480251   1/1  lilglpilflgtgenvddlevfnpgelvdrl---------------------------------------
00405881   1/1  ailellkgklvlyeg-------------------------------------------------------
00482551   1/1  Lkrlakelgvtviltsqltrevedradkrpdlsdlrgggaleqladtvlller.........--------
00394721   1/1  ----------------------------------------------------------------------
00513761   1/1  ----------------------------------------------------------------------
00367291   1/1  ----------------------------------------------------------------------
00386741   1/1  ----------------------------------------------------------------------
00521551   1/1  ----------------------------------------------------------------------
00472911   1/1  ----------------------------------------------------------------------
00496061   1/1  ......grllereddseevlekrlerylelye--------------------------------------
00432181   1/1  ----------------------------------------------------------------------
00439861   1/1  kelgvtvilvsqlt--------------------------------------------------------
00473941   1/1  ----------------------------------------------------------------------
00513251   1/1  degslvdlgvledlla------------------------------------------------------
00402371   1/1  leegnvrviaatnrpelvklg-------------------------------------------------
00437921   1/1  ----------------------------------------------------------------------
00527261   1/1  ----------------------------------------------------------------------
00457851   1/1  e---------------------------------------------------------------------
00457881   1/1  ivi-------------------------------------------------------------------
00486581   1/1  ----------------------------emNllegkvl.gggvvlgglrlplp....aaggkvvvgiRPe
00469161   1/1  ----------------------------------------------------------------------
00519581   1/1  aeeldkdglleelrklldlidkydalkvdtd---------------------------------------
00478391   1/1  ----------------------------------------------------------------------
00489391   1/1  ----------------------------------------------------------------------
00476071   1/1  ----------------------------------------------------------------------
00430121   1/1  ----------------------------------------------------------------------
00478081   1/1  ----------------------------------------------------------------------
00461621   1/1  ----------------------------------------------------------------------
00487061   1/1  ----------------------------------------------------------------------
00418301   1/1  ----------------------------------------------------------------------
00482721   1/1  ..l-------------------------------------------------------------------
00493171   1/1  d---------------------------------------------------------------------
00517691   1/1  ----------------------------------------------------------------------
00416171   1/1  ----------------------------------------------------------------------
00511381   1/1  l---------------------------------------------------------------------
00495771   1/1  ----------------------------------------------------------------------
00410531   1/1  ----------------------------------------------------------------------
00516041   1/1  leeaddlvidtanldleevveeilellee..pl-------------------------------------
00477561   1/1  ----------------------------------------------------------------------
00497571   1/1  ......................nlrdlfelar.-------------------------------------
00462581   1/1  ----------------------------------------------------------------------
00482661   1/1  ----------------------------------------------------------------------
00474201   1/1  ----------------------------------------------------------------------
00463151   1/1  sleer-----------------------------------------------------------------
00409841   1/1  ----------------------------------------------------------------------
00480501   1/1  gr--------------------------------------------------------------------
00488571   1/1  -----------------------------SPpMNflpgtvvggggglvllevlllgglrlplpaallala
00486921   1/1  ----------------------------------------------------------------------
00477721   1/1  ----------------------------------------------------------------------
00512061   1/1  ----------------------------------------------------------------------
00509891   1/1  adllvlnkldlveiadfilekl------------------------------------------------
00401211   1/1  ----------------------------------------------------------------------
00515801   1/1  ----------------------------------------------------------------------
00471271   1/1  ----------------------------------------------------------------------
00476651   1/1  ----------------------------------------------------------------------
00478131   1/1  ----------------------------------------------------------------------
00493981   1/1  ----------------------------------------------------------------------
00410321   1/1  ----------------------------------------------------------------------
00479331   1/1  dl--------------------------------------------------------------------
00420081   1/1  ----------------------------------------------------------------------
00501941   1/1  ----------------------------------------------------------------------
00483811   1/1  ----------------------------------------------------------------------
00486891   1/1  ----------------------------------------------------------------------
00441251   1/1  ----------------------------------------------------------------------
00464591   1/1  ----------------------------------------------------------------------
00491901   1/1  ----------------------------------------------------------------------
00378621   1/1  ----------------------------------------------------------------------
00490531   1/1  ----------------------------------------------------------------------
00518511   1/1  ----------------------------------------------------------------------
00493061   1/1  ----------------------------------------------------------------------
00459701   1/1  ----------------------------------------------------------------------
00363171   1/1  ----------------------------------------------------------------------
00494911   1/1  ----------------------------------------------------------------------
00402381   1/1  ----------------------------------------------------------------------
00464421   1/1  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           DLVLTSPEKGQLKVKVDTQLFRGVHYEIRCTDALGNKWLVHSTKRAVPGENIGLSFGPEDIHVMRFNESE
00378981   1/1  ----------------------------------------------------------------------
00420701   1/1  ----------------------------------------------------------------------
00425571   1/1  ----------------------------------------------------------------------
00485451   1/1  ----------------------------------------------------------------------
00379581   1/1  ----------------------------------------------------------------------
00500441   1/1  ----------------------------------------------------------------------
00390411   1/1  ----------------------------------------------------------------------
00422801   1/1  ----------------------------------------------------------------------
00495371   1/1  ----------------------------------------------------------------------
00490801   1/1  ----------------------------------------------------------------------
00510251   1/1  ----------------------------------------------------------------------
00440861   1/1  ----------------------------------------------------------------------
00361211   1/1  ----------------------------------------------------------------------
00475891   1/1  ----------------------------------------------------------------------
00482201   1/1  ----------------------------------------------------------------------
00458601   1/1  ----------------------------------------------------------------------
00502741   1/1  ----------------------------------------------------------------------
00498251   1/1  ----------------------------------------------------------------------
00482261   1/1  ----------------------------------------------------------------------
00367901   1/1  ----------------------------------------------------------------------
00404101   1/1  ----------------------------------------------------------------------
00509431   1/1  ----------------------------------------------------------------------
00475991   1/1  ----------------------------------------------------------------------
00530591   1/1  ----------------------------------------------------------------------
00436071   1/1  ----------------------------------------------------------------------
00466971   1/1  ----------------------------------------------------------------------
00466931   1/1  ----------------------------------------------------------------------
00424961   1/1  ----------------------------------------------------------------------
00500611   1/1  ----------------------------------------------------------------------
00469451   1/1  ----------------------------------------------------------------------
00468691   1/1  ----------------------------------------------------------------------
00372301   1/1  ----------------------------------------------------------------------
00488521   1/1  ----------------------------------------------------------------------
00496111   1/1  ----------------------------------------------------------------------
00457311   1/1  ----------------------------------------------------------------------
00495031   1/1  ----------------------------------------------------------------------
00436511   1/1  ----------------------------------------------------------------------
00379601   1/1  ----------------------------------------------------------------------
00367481   1/1  ----------------------------------------------------------------------
00493431   1/1  ----------------------------------------------------------------------
00532531   1/1  ----------------------------------------------------------------------
00485931   1/1  ----------------------------------------------------------------------
00448931   1/1  ----------------------------------------------------------------------
00503371   1/1  ----------------------------------------------------------------------
00422141   1/1  ----------------------------------------------------------------------
00468601   1/1  ----------------------------------------------------------------------
00437981   1/1  ----------------------------------------------------------------------
00487021   1/1  ----------------------------------------------------------------------
00478411   1/1  ----------------------------------------------------------------------
00475521   1/1  ----------------------------------------------------------------------
00381441   1/1  ----------------------------------------------------------------------
00371631   1/1  ----------------------------------------------------------------------
00477971   1/1  ----------------------------------------------------------------------
00475371   1/1  ----------------------------------------------------------------------
00368501   1/1  ----------------------------------------------------------------------
00464791   1/1  ----------------------------------------------------------------------
00533501   1/1  ----------------------------------------------------------------------
00478441   1/1  ----------------------------------------------------------------------
00462761   1/1  ----------------------------------------------------------------------
00464411   1/1  ----------------------------------------------------------------------
00414121   1/1  ----------------------------------------------------------------------
00496571   1/1  ----------------------------------------------------------------------
00426051   1/1  ----------------------------------------------------------------------
00475381   1/1  ----------------------------------------------------------------------
00480471   1/1  ----------------------------------------------------------------------
00468951   1/1  ----------------------------------------------------------------------
00515531   1/1  ----------------------------------------------------------------------
00437941   1/1  ----------------------------------------------------------------------
00387201   1/1  ----------------------------------------------------------------------
00379961   1/1  ----------------------------------------------------------------------
00510561   1/1  ----------------------------------------------------------------------
00470731   1/1  ----------------------------------------------------------------------
00512891   1/1  ----------------------------------------------------------------------
00503741   1/1  ----------------------------------------------------------------------
00515511   1/1  ----------------------------------------------------------------------
00379261   1/1  ----------------------------------------------------------------------
00480441   1/1  ----------------------------------------------------------------------
00498811   1/1  ----------------------------------------------------------------------
00489571   1/1  ----------------------------------------------------------------------
00490731   1/1  ----------------------------------------------------------------------
00532471   1/1  ----------------------------------------------------------------------
00498531   1/1  ----------------------------------------------------------------------
00356411   1/1  ----------------------------------------------------------------------
00434401   1/1  ----------------------------------------------------------------------
00392701   1/1  ----------------------------------------------------------------------
00499331   1/1  ----------------------------------------------------------------------
00406781   1/1  ----------------------------------------------------------------------
00484101   1/1  ----------------------------------------------------------------------
00368571   1/1  ----------------------------------------------------------------------
00404191   1/1  ----------------------------------------------------------------------
00508671   1/1  ----------------------------------------------------------------------
00420941   1/1  ----------------------------------------------------------------------
00499191   1/1  ----------------------------------------------------------------------
00444381   1/1  ----------------------------------------------------------------------
00477011   1/1  ----------------------------------------------------------------------
00533151   1/1  ----------------------------------------------------------------------
00489631   1/1  ----------------------------------------------------------------------
00451571   1/1  ----------------------------------------------------------------------
00515351   1/1  ----------------------------------------------------------------------
00437901   1/1  ----------------------------------------------------------------------
00480251   1/1  ----------------------------------------------------------------------
00405881   1/1  ----------------------------------------------------------------------
00482551   1/1  ----------------------------------------------------------------------
00394721   1/1  ----------------------------------------------------------------------
00513761   1/1  ----------------------------------------------------------------------
00367291   1/1  ----------------------------------------------------------------------
00386741   1/1  ----------------------------------------------------------------------
00521551   1/1  ----------------------------------------------------------------------
00472911   1/1  ----------------------------------------------------------------------
00496061   1/1  ----------------------------------------------------------------------
00432181   1/1  ----------------------------------------------------------------------
00439861   1/1  ----------------------------------------------------------------------
00473941   1/1  ----------------------------------------------------------------------
00513251   1/1  ----------------------------------------------------------------------
00402371   1/1  ----------------------------------------------------------------------
00437921   1/1  ----------------------------------------------------------------------
00527261   1/1  ----------------------------------------------------------------------
00457851   1/1  ----------------------------------------------------------------------
00457881   1/1  ----------------------------------------------------------------------
00486581   1/1  dirlskdgladsglantlkgkVevveylGsetlltvrlg.geelvvrlpgelplkvgeevylsf------
00469161   1/1  ----------------------------------------------------------------------
00519581   1/1  ----------------------------------------------------------------------
00478391   1/1  ----------------------------------------------------------------------
00489391   1/1  ----------------------------------------------------------------------
00476071   1/1  ----------------------------------------------------------------------
00430121   1/1  ----------------------------------------------------------------------
00478081   1/1  ----------------------------------------------------------------------
00461621   1/1  ----------------------------------------------------------------------
00487061   1/1  ----------------------------------------------------------------------
00418301   1/1  ----------------------------------------------------------------------
00482721   1/1  ----------------------------------------------------------------------
00493171   1/1  ----------------------------------------------------------------------
00517691   1/1  ----------------------------------------------------------------------
00416171   1/1  ----------------------------------------------------------------------
00511381   1/1  ----------------------------------------------------------------------
00495771   1/1  ----------------------------------------------------------------------
00410531   1/1  ----------------------------------------------------------------------
00516041   1/1  ----------------------------------------------------------------------
00477561   1/1  ----------------------------------------------------------------------
00497571   1/1  ----------------------------------------------------------------------
00462581   1/1  ----------------------------------------------------------------------
00482661   1/1  ----------------------------------------------------------------------
00474201   1/1  ----------------------------------------------------------------------
00463151   1/1  ----------------------------------------------------------------------
00409841   1/1  ----------------------------------------------------------------------
00480501   1/1  ----------------------------------------------------------------------
00488571   1/1  aggevtlGiRPEhlrladegdlalegtVevvellGsetllyvrlgggdqllvarvpgrlllepgdtvrla
00486921   1/1  ----------------------------------------------------------------------
00477721   1/1  ----------------------------------------------------------------------
00512061   1/1  ----------------------------------------------------------------------
00509891   1/1  ----------------------------------------------------------------------
00401211   1/1  ----------------------------------------------------------------------
00515801   1/1  ----------------------------------------------------------------------
00471271   1/1  ----------------------------------------------------------------------
00476651   1/1  ----------------------------------------------------------------------
00478131   1/1  ----------------------------------------------------------------------
00493981   1/1  ----------------------------------------------------------------------
00410321   1/1  ----------------------------------------------------------------------
00479331   1/1  ----------------------------------------------------------------------
00420081   1/1  ----------------------------------------------------------------------
00501941   1/1  ----------------------------------------------------------------------
00483811   1/1  ----------------------------------------------------------------------
00486891   1/1  ----------------------------------------------------------------------
00441251   1/1  ----------------------------------------------------------------------
00464591   1/1  ----------------------------------------------------------------------
00491901   1/1  ----------------------------------------------------------------------
00378621   1/1  ----------------------------------------------------------------------
00490531   1/1  ----------------------------------------------------------------------
00518511   1/1  ----------------------------------------------------------------------
00493061   1/1  ----------------------------------------------------------------------
00459701   1/1  ----------------------------------------------------------------------
00363171   1/1  ----------------------------------------------------------------------
00494911   1/1  ----------------------------------------------------------------------
00402381   1/1  ----------------------------------------------------------------------
00464421   1/1  ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           EDFDARLDSYND----------------------------------------------------------
00378981   1/1  ----------------------------------------------------------------------
00420701   1/1  ----------------------------------------------------------------------
00425571   1/1  ----------------------------------------------------------------------
00485451   1/1  ----------------------------------------------------------------------
00379581   1/1  ----------------------------------------------------------------------
00500441   1/1  ----------------------------------------------------------------------
00390411   1/1  ----------------------------------------------------------------------
00422801   1/1  ----------------------------------------------------------------------
00495371   1/1  ----------------------------------------------------------------------
00490801   1/1  ----------------------------------------------------------------------
00510251   1/1  ----------------------------------------------------------------------
00440861   1/1  ----------------------------------------------------------------------
00361211   1/1  ----------------------------------------------------------------------
00475891   1/1  ----------------------------------------------------------------------
00482201   1/1  ----------------------------------------------------------------------
00458601   1/1  ----------------------------------------------------------------------
00502741   1/1  ----------------------------------------------------------------------
00498251   1/1  ----------------------------------------------------------------------
00482261   1/1  ----------------------------------------------------------------------
00367901   1/1  ----------------------------------------------------------------------
00404101   1/1  ----------------------------------------------------------------------
00509431   1/1  ----------------------------------------------------------------------
00475991   1/1  ----------------------------------------------------------------------
00530591   1/1  ----------------------------------------------------------------------
00436071   1/1  ----------------------------------------------------------------------
00466971   1/1  ----------------------------------------------------------------------
00466931   1/1  ----------------------------------------------------------------------
00424961   1/1  ----------------------------------------------------------------------
00500611   1/1  ----------------------------------------------------------------------
00469451   1/1  ----------------------------------------------------------------------
00468691   1/1  ----------------------------------------------------------------------
00372301   1/1  ----------------------------------------------------------------------
00488521   1/1  ----------------------------------------------------------------------
00496111   1/1  ----------------------------------------------------------------------
00457311   1/1  ----------------------------------------------------------------------
00495031   1/1  ----------------------------------------------------------------------
00436511   1/1  ----------------------------------------------------------------------
00379601   1/1  ----------------------------------------------------------------------
00367481   1/1  ----------------------------------------------------------------------
00493431   1/1  ----------------------------------------------------------------------
00532531   1/1  ----------------------------------------------------------------------
00485931   1/1  ----------------------------------------------------------------------
00448931   1/1  ----------------------------------------------------------------------
00503371   1/1  ----------------------------------------------------------------------
00422141   1/1  ----------------------------------------------------------------------
00468601   1/1  ----------------------------------------------------------------------
00437981   1/1  ----------------------------------------------------------------------
00487021   1/1  ----------------------------------------------------------------------
00478411   1/1  ----------------------------------------------------------------------
00475521   1/1  ----------------------------------------------------------------------
00381441   1/1  ----------------------------------------------------------------------
00371631   1/1  ----------------------------------------------------------------------
00477971   1/1  ----------------------------------------------------------------------
00475371   1/1  ----------------------------------------------------------------------
00368501   1/1  ----------------------------------------------------------------------
00464791   1/1  ----------------------------------------------------------------------
00533501   1/1  ----------------------------------------------------------------------
00478441   1/1  ----------------------------------------------------------------------
00462761   1/1  ----------------------------------------------------------------------
00464411   1/1  ----------------------------------------------------------------------
00414121   1/1  ----------------------------------------------------------------------
00496571   1/1  ----------------------------------------------------------------------
00426051   1/1  ----------------------------------------------------------------------
00475381   1/1  ----------------------------------------------------------------------
00480471   1/1  ----------------------------------------------------------------------
00468951   1/1  ----------------------------------------------------------------------
00515531   1/1  ----------------------------------------------------------------------
00437941   1/1  ----------------------------------------------------------------------
00387201   1/1  ----------------------------------------------------------------------
00379961   1/1  ----------------------------------------------------------------------
00510561   1/1  ----------------------------------------------------------------------
00470731   1/1  ----------------------------------------------------------------------
00512891   1/1  ----------------------------------------------------------------------
00503741   1/1  ----------------------------------------------------------------------
00515511   1/1  ----------------------------------------------------------------------
00379261   1/1  ----------------------------------------------------------------------
00480441   1/1  ----------------------------------------------------------------------
00498811   1/1  ----------------------------------------------------------------------
00489571   1/1  ----------------------------------------------------------------------
00490731   1/1  ----------------------------------------------------------------------
00532471   1/1  ----------------------------------------------------------------------
00498531   1/1  ----------------------------------------------------------------------
00356411   1/1  ----------------------------------------------------------------------
00434401   1/1  ----------------------------------------------------------------------
00392701   1/1  ----------------------------------------------------------------------
00499331   1/1  ----------------------------------------------------------------------
00406781   1/1  ----------------------------------------------------------------------
00484101   1/1  ----------------------------------------------------------------------
00368571   1/1  ----------------------------------------------------------------------
00404191   1/1  ----------------------------------------------------------------------
00508671   1/1  ----------------------------------------------------------------------
00420941   1/1  ----------------------------------------------------------------------
00499191   1/1  ----------------------------------------------------------------------
00444381   1/1  ----------------------------------------------------------------------
00477011   1/1  ----------------------------------------------------------------------
00533151   1/1  ----------------------------------------------------------------------
00489631   1/1  ----------------------------------------------------------------------
00451571   1/1  ----------------------------------------------------------------------
00515351   1/1  ----------------------------------------------------------------------
00437901   1/1  ----------------------------------------------------------------------
00480251   1/1  ----------------------------------------------------------------------
00405881   1/1  ----------------------------------------------------------------------
00482551   1/1  ----------------------------------------------------------------------
00394721   1/1  ----------------------------------------------------------------------
00513761   1/1  ----------------------------------------------------------------------
00367291   1/1  ----------------------------------------------------------------------
00386741   1/1  ----------------------------------------------------------------------
00521551   1/1  ----------------------------------------------------------------------
00472911   1/1  ----------------------------------------------------------------------
00496061   1/1  ----------------------------------------------------------------------
00432181   1/1  ----------------------------------------------------------------------
00439861   1/1  ----------------------------------------------------------------------
00473941   1/1  ----------------------------------------------------------------------
00513251   1/1  ----------------------------------------------------------------------
00402371   1/1  ----------------------------------------------------------------------
00437921   1/1  ----------------------------------------------------------------------
00527261   1/1  ----------------------------------------------------------------------
00457851   1/1  ----------------------------------------------------------------------
00457881   1/1  ----------------------------------------------------------------------
00486581   1/1  ----------------------------------------------------------------------
00469161   1/1  ----------------------------------------------------------------------
00519581   1/1  ----------------------------------------------------------------------
00478391   1/1  ----------------------------------------------------------------------
00489391   1/1  ----------------------------------------------------------------------
00476071   1/1  ----------------------------------------------------------------------
00430121   1/1  ----------------------------------------------------------------------
00478081   1/1  ----------------------------------------------------------------------
00461621   1/1  ----------------------------------------------------------------------
00487061   1/1  ----------------------------------------------------------------------
00418301   1/1  ----------------------------------------------------------------------
00482721   1/1  ----------------------------------------------------------------------
00493171   1/1  ----------------------------------------------------------------------
00517691   1/1  ----------------------------------------------------------------------
00416171   1/1  ----------------------------------------------------------------------
00511381   1/1  ----------------------------------------------------------------------
00495771   1/1  ----------------------------------------------------------------------
00410531   1/1  ----------------------------------------------------------------------
00516041   1/1  ----------------------------------------------------------------------
00477561   1/1  ----------------------------------------------------------------------
00497571   1/1  ----------------------------------------------------------------------
00462581   1/1  ----------------------------------------------------------------------
00482661   1/1  ----------------------------------------------------------------------
00474201   1/1  ----------------------------------------------------------------------
00463151   1/1  ----------------------------------------------------------------------
00409841   1/1  ----------------------------------------------------------------------
00480501   1/1  ----------------------------------------------------------------------
00488571   1/1  f---------------------------------------------------------------------
00486921   1/1  ----------------------------------------------------------------------
00477721   1/1  ----------------------------------------------------------------------
00512061   1/1  ----------------------------------------------------------------------
00509891   1/1  ----------------------------------------------------------------------
00401211   1/1  ----------------------------------------------------------------------
00515801   1/1  ----------------------------------------------------------------------
00471271   1/1  ----------------------------------------------------------------------
00476651   1/1  ----------------------------------------------------------------------
00478131   1/1  ----------------------------------------------------------------------
00493981   1/1  ----------------------------------------------------------------------
00410321   1/1  ----------------------------------------------------------------------
00479331   1/1  ----------------------------------------------------------------------
00420081   1/1  ----------------------------------------------------------------------
00501941   1/1  ----------------------------------------------------------------------
00483811   1/1  ----------------------------------------------------------------------
00486891   1/1  ----------------------------------------------------------------------
00441251   1/1  ----------------------------------------------------------------------
00464591   1/1  ----------------------------------------------------------------------
00491901   1/1  ----------------------------------------------------------------------
00378621   1/1  ----------------------------------------------------------------------
00490531   1/1  ----------------------------------------------------------------------
00518511   1/1  ----------------------------------------------------------------------
00493061   1/1  ----------------------------------------------------------------------
00459701   1/1  ----------------------------------------------------------------------
00363171   1/1  ----------------------------------------------------------------------
00494911   1/1  ----------------------------------------------------------------------
00402381   1/1  ----------------------------------------------------------------------
00464421   1/1  ----------------------------------------------------------------------