[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for lsal0:ABD98951.1


[Show Plain Result]

## Summary of Sequence Search
   1::214
   6::214  1.6e-51 34.0% 0044736 00447361 1/1   ependent nitroreductase-like            
   8::214  2.3e-50 34.8% 0036576 00365761 1/1   ependent nitroreductase-like            
   7::214  2.8e-50 32.3% 0051924 00519241 1/1   ependent nitroreductase-like            
   7::213  6.3e-49 33.1% 0035601 00356011 1/1   ependent nitroreductase-like            
   7::214  5.2e-48 37.4% 0041494 00414941 1/1   ependent nitroreductase-like            
   8::211  6.3e-48 34.8% 0041335 00413351 1/1   ependent nitroreductase-like            
   7::213  7.4e-46 33.1% 0051556 00515561 1/1   ependent nitroreductase-like            
   6::213    1e-41 33.0% 0037401 00374011 1/1   ependent nitroreductase-like            
   3::214  1.7e-39 31.1% 0051432 00514321 1/1   ependent nitroreductase-like            
   7::213  1.9e-39 34.1% 0052748 00527481 1/1   ependent nitroreductase-like            
   7::216  1.7e-32 27.8% 0053102 00531021 1/1   ependent nitroreductase-like            
   8::194  3.8e-32 36.9% 0044848 00448481 1/1   ependent nitroreductase-like            
   1::214


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MTNFKNNDFESVMLGRHSVRKFDTSVKIPREELKEMVANAITAPSACNLQAWHFIVVDTPEGKDKLRSFF
00447361   1/1  -----mmdlleliksRrsvRafdtdkpvpdevleelleaarlAPSsgnlqpwrfvvvedpelkeklaell
00365761   1/1  -------mdvlelilsRrsvRafdpdkpisdedleeileaarlAPSsvnlqpwrfvvvrseelkeklael
00519241   1/1  ------mdllellksRrSvrkfdde.pvsdevleeileaarlAPSsgnlqpwrfvvvtdpelreklaeal
00356011   1/1  ------mdllelilsRrSvRkFt.depvpdevleelleaarlAPssgnlqpwrfvvvtdpelreklaell
00414941   1/1  ------pmmdvleailsRrsvRkFdpk.pipdedleeileaarlAPSslnlQpwrfvvvedeelkeklae
00413351   1/1  -------dvleailsRrsvRafdpdkpvsdedleeileaarlAPSsvnlQpwrfvvvrdeelkeklaeaa
00515561   1/1  ------mmdlleliksRrSvRkFdde.pvsdevleeileaarlAPSsgnlQpwrfvvvtdpelkeklael
00374011   1/1  -----mmellelilsRrSvRkFtde.pvpeevleelleaArlAPSsgnlqpwrfivvtdpelreklaela
00514321   1/1  --lllmmdlleliksRrSvRkfkdelpvsdevleeileaarlAPSsgnlqpwrfvvvtdeelkkllaela
00527481   1/1  ------lllllllllmmdllelllsRrSvrafdde.pvpeevleeileaArlAPSsgnlqpwrfvvvtrd
00531021   1/1  ------mdflellkkRrSvrafdpdlkisdeelielileaaklAPSafNsQpwrfvvvlgeehkklwdiv
00448481   1/1  -------dvleaiksRrSvRkFl.dkpvpkelleeilea..........qPWrfvvvtgeelkeklaall


                         -         -         *         -         -         -         -:140
query           MKFNLPQLETSSAIVMLFGDTLAFKKYRALWENIYEQKQISKEELDRILNTFLPLYENADKQLLTADAMV
00447361   1/1  aealegnqeqlldapvlivvladtdrleelvellldrrvevglllyealgnlllflapvlllllgdkvla
00365761   1/1  aagalafnqpqvldasalvvvladtdltelllelyldallelgrlldeeraalllllrgffaallllsla
00519241   1/1  ..gnqekvldapvlivvlad.ldrarklplleqlygalgifeedlealleqllrnfllfgaellllwall
00356011   1/1  ..gnqeyvadapvlivvvadlerlaklpellq..........................lgelelllvall
00414941   1/1  la..fnqpqvldasalivfladldralaildlvlllllad....elllalllallglflalgeetlldwa
00413351   1/1  agalafnqpqvldasvlivvladtdlteellelvldllvelgrtldeeleaavllllaafaellllllrd
00515561   1/1  a..gnqpyvadapvlivvvadldrvekllelfglaaaall....................gelelllwal
00374011   1/1  ..lgqeyladapvllvvvadldrlakllellg..........................lgeltlllyalv
00514321   1/1  eallalvpeeaflatelnqegfldApvlivvfadldlveklpelf.........................
00527481   1/1  gelkeklaellaegnqeklldapvlivvladldlseklpe..............................
00531021   1/1  a..enlkkvvpasavfavtgdllalfkagygtilffedgavvealqelfp.......lyadnfpvwseas
00448481   1/1  lgnk..qlfgApalivvvadk.d..........................................eyall


                         +         -         -         -         -         *         -:210
query           DSSLAAMQFMLAARAHGYDTNPIAGYDAKKAATALGLDPERYVPVMAIAVGKADSQSTDIKSTRYSVDDV
00447361   1/1  dwalldaglaaqnlllaAralGlgtcpiggfdpeavrellgldpegyrpvallalGypdeeadvnalppk
00365761   1/1  dlrdwalrdaglaagnlmlaAralGldtcpmggfdpekvrelLglpedgyvpvvlvalGyrdeeallprl
00519241   1/1  dagiaaqnlllaAaalGlgtcpiggfdpeavrellglp.egerpvallalGypdee..pppkpRlpleev
00356011   1/1  dagiaaqnlllaAralGLgtcwiggflnddeavrelLgl.pedevpvaglalGypaee..pppkprlple
00414941   1/1  lldaylaaqnlllaAralGlgtcpiggfdpekvrelLgl.pegyvpvvllalGypaeepl..pkpRlple
00413351   1/1  lrdwaardaglaaqnlmlaAralGldtcpmggfdaekvrelLglpedgyvpvvlvalGyrdeeallprlp
00515561   1/1  vdagiaaqnlllaAaalGLgtcpiggfrndpeavrelLglp.egykpvallalGypdeepp..pkpRlpl
00374011   1/1  dagiaaqnlllaAealGLgtcwiggfrndpeavrelLglp.edvvpvaglalGypaee.ppvkp.rlple
00514321   1/1  .plgaellplwalldagiaaqnlllaAralGlgtcwigylgfddeavrellgl.pedlklvallalGypd
00527481   1/1  ..lllllealldagiaaqnlllaAralGlgtcwiggfdpeavrellglp.egerpvallalGypdeeapl
00531021   1/1  sgmalaamwlalaaeglGaslqhynpliddavaellni.PedwklvallpfGypeepag..ekerlplee
00448481   1/1  dtgialqnlmLaAtalGLgtcwiggfddkdlvlilviglprlaeaektrrplfe----------------


                         -         -         -         +         -         -         -:280
query           IEFQ------------------------------------------------------------------
00447361   1/1  pRlp------------------------------------------------------------------
00365761   1/1  pkpR------------------------------------------------------------------
00519241   1/1  vtfl------------------------------------------------------------------
00356011   1/1  evv-------------------------------------------------------------------
00414941   1/1  evvt------------------------------------------------------------------
00413351   1/1  k---------------------------------------------------------------------
00515561   1/1  eev-------------------------------------------------------------------
00374011   1/1  evv-------------------------------------------------------------------
00514321   1/1  eepp------------------------------------------------------------------
00527481   1/1  pel-------------------------------------------------------------------
00531021   1/1  rvkvfg----------------------------------------------------------------
00448481   1/1  ----------------------------------------------------------------------