[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for lsal0:ABD99160.1


[Show Plain Result]

## Summary of Sequence Search
   1::82
   1::84   1.3e-22 42.9% 0050310 00503101 1/1   like                                    
   1::82


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MKQGIHPDYHEVVFMDSATGYKFLSGSTKNSEETIEWEDGNTYPLIRVEISSDSHPFYTGRQKFTQADGR
00503101   1/1  mkkdiHPeyrevvvvctsgnlvftlsst..............gpellldvcskshPfytGkqklvdtgGr


                         -         -         *         -         -         -         -:140
query           VDRFNKKYGFTN----------------------------------------------------------
00503101   1/1  vekFnkrfgllllg--------------------------------------------------------