[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for lsal0:ABD99233.1


[Show Plain Result]

## Summary of Sequence Search
   1::307
   2::305  2.5e-80 38.0% 0052784 00527841 1/1   inase-like                              
   1::299    6e-80 38.0% 0046332 00463321 1/1   inase-like                              
   2::308  1.1e-77 38.7% 0043278 00432781 1/1   inase-like                              
   1::305  5.4e-77 39.1% 0051760 00517601 1/1   inase-like                              
   3::306  1.1e-75 38.7% 0051741 00517411 1/1   inase-like                              
   1::307  4.3e-75 38.3% 0050248 00502481 1/1   inase-like                              
   4::299  1.3e-74 38.4% 0046030 00460301 1/1   inase-like                              
   1::307  9.3e-74 39.2% 0052420 00524201 1/1   inase-like                              
   4::305  3.8e-73 37.9% 0052553 00525531 1/1   inase-like                              
   3::305  1.9e-69 38.4% 0044587 00445871 1/1   inase-like                              
   3::305  7.6e-63 38.4% 0049742 00497421 1/1   inase-like                              
   1::301  3.7e-62 39.9% 0050218 00502181 1/1   inase-like                              
   3::306  3.6e-59 35.5% 0051780 00517801 1/1   inase-like                              
  25::301  7.6e-49 34.6% 0040500 00405001 1/1   inase-like                              
   1::305  1.1e-41 33.9% 0050193 00501931 1/1   inase-like                              
   1::308    5e-41 32.9% 0047705 00477051 1/1   inase-like                              
   2::302    1e-38 32.1% 0049846 00498461 1/1   inase-like                              
 105::291  4.5e-34 35.9% 0046577 00465771 1/1   inase-like                              
  78::295    2e-33 31.0% 0044661 00446611 1/1   inase-like                              
  38::295  7.2e-26 23.6% 0047908 00479081 1/1   inase-like                              
  11::304  2.8e-20 21.2% 0051846 00518461 1/1   inase-like                              
   1::307


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MSNKVTVLGSLNVDTILRIPRLPQPGETLKMDDIGVAGGGKGANQAISAARSKSHVTFIGGVGNDVQGEM
00527841   1/1  -mlkvlviGnallDliltvdelplpgevlrvgsfelvpGGagaNvavalarlgadvaligavGdDafgdf
00463321   1/1  MkmldilviGealvDliatvddefleklglkkgsailiseerlpllgel.lagsfrlvpGGaaaNvaval
00432781   1/1  -mmkvlvvGnallDliltvdslpapgevvlviagsvsaGGaganvavalarlgadvaligavGdDefgqa
00517601   1/1  mkmldvlviGealvDlv.....ppapgelllatsfekgpGGaaaNvAvalarlgldvafigavgdDafgd
00517411   1/1  --mkvlviGnallDlilrvdrlp.pgetvrvgsfrlvpGGagaNvavalarlgadvaligavGdd.fgdf
00502481   1/1  kmmkvlviGnallDliltvdslpapgevvraesfrlrpGGkaanvavalarlgadlvallgavGdDsfgd
00460301   1/1  ---mkklkvlviGealvDliatvddefleklglkkglmilideerlpelgetllagsfelvpGGsaaNva
00524201   1/1  M..kilviGeallDlil.....peagellralslelrpGGsaanvavalarlgakvaligavGdDefgdf
00525531   1/1  ---mivtvtgnpalDlilrldrlp.lgetvrvgsfrkspGGkgaNvAvalarlGadvaligavGdd.fgd
00445871   1/1  --mldvlviGeallDlia.....papgelvrvesfrlvpGGkaaNvAvalarlGadvalvgavGdDefgd
00497421   1/1  --kdvlviGeallDliltvdg...........slrlrpGGaaanvavalarlgadvallgavGdDafgdf
00502181   1/1  llllkmlkilvvGnaliDlivtvd............sflkalGGsaanvavalarlglkvaligavGdde
00517801   1/1  --mkilvvGnllvDiilvvdrlplegetllleasslkvspGGnalnvAvalarlglrvslvgavGnD.aG
00405001   1/1  ------------------------mprvLtiags.dssGgaGinaalkalaalGvd..............
00501931   1/1  kmprvlviag.........................sdpgGgagnqAdlkalaalgvdvaav.........
00477051   1/1  gtmprvlviggsd.........................pgGgagnqAdlkalaalgvyvtav........
00498461   1/1  -mgrvlvigg.........................sdsgGgaginaalkalaalgvdvtlv.........
00465771   1/1  ----------------------------------------------------------------------
00446611   1/1  ----------------------------------------------------------------------
00479081   1/1  -------------------------------------lllllllellllllpvrdldshKgsfGrvlvia
00518461   1/1  ----------llellllllplrsadshKgsfGrvlviaGsdgygGAailaalaalrlGaglvtvaalgga


                         -         -         *         -         -         -         -:140
query           MLKLLKEDGININNVAKLNEGTGQAFILLQESGENSIVIYGGANQAIKTTVIQNAMNDIKDSDFLVAQFE
00527841   1/1  llelleeegvdtslvlvdpgaptglalilvdpdgertiifylgaaalltpedldallelladadvvvlsg
00463321   1/1  arlldeGakvaligavGdDafgdfllelleaegvdtslvvvpgrpTglalilvd.dgertfvfylgaaal
00432781   1/1  llktlqalgvdtsfvrvdegaptglalvlldadgertilaylgaaaellpelldallellkgadavvlgg
00517601   1/1  fllealreegvdtslvlrdpgptglalilvdadgersivfylreggaaallspddldlel.llagadvlh
00517411   1/1  llelleeegvdtsfvvv.pgptglalvlv.d.gertilvydgaaaaalllelldlllellkdadavvlgg
00502481   1/1  allellealgvdtslv.r.daptglalilvdadgertivvylgaaaeltpedld..lallaaadivvlsg
00460301   1/1  valarllgldgakvafigavGdDefgdfllellkkegvdtslvvvdegtttglalilvd.gertivtylg
00524201   1/1  llellkkegvdtslvlvdegrptglaliellvdadgertivtylggsaaaeltpedld..lellkdadav
00525531   1/1  fllellkkegvdtsfvrvdggtrtgvalvvtddgertilvlpgasaalllelldlllellkdadvlvlsg
00445871   1/1  fllellreegvdtsfvrvdggptglalilvdpdgertivfyrgpgaallltpedldll..llagadlvhl
00497421   1/1  llellegagvdtdlvtvdpgrptglalilvdadgertvvfylgasadlllldllld..lledadvvvlsg
00502181   1/1  fge.l.dllrelgvdtslv..pggptglalvlldedgertivlylgan.....llldlleellkdadivh
00517801   1/1  kllleeleeegidtsgvlvlpdgetgvalilldkdgervtlivlpgaavllleldllvpalldllenadl
00405001   1/1  .......................gtavitvltsgntgygvfagan..lspedlaeqldalledllkevda
00501931   1/1  ............................italtsqntgygvfpgav..lspeelealleallellldlda
00477051   1/1  ..............................italtaqntigv..gavlalppellaaqlealledlgada
00498461   1/1  .............................italtaqntilvlpgaa..lspeelaellealleladadav
00465771   1/1  ----------------------------------idsgggagigadllaalalgrygtglvtvltaqntl
00446611   1/1  -------Gagiladlkalrlgaglvtvitnlvaqntiavyllalgalplmaevleeleellkdadalvig
00479081   1/1  GsdgygGAailaalaalraga......................................glvtvatpdnt
00518461   1/1  .............................aaplitalpelvvlgvlanaspimadlleellelleradal


                         +         -         -         -         -         *         -:210
query           TPLEVTNEAFKLARELNVKTILNPAPATDILDELKKNIDLIIPNETEAELLTGIKVVDEDTCRQAADKLI
00527841   1/1  ylpleallallelakeagvpvvlDpngrplllleellpladllkpneeEaelltgllllsledleeaara
00463321   1/1  lspedld..lallagadvlhlsgyllgelpreallellelareagvlvvldpnprpllwlsrelllellp
00432781   1/1  llpaeavlallelakeagvpvvlDpvmrdalleellpladiltpneeEaelltglkiedledleeaarkl
00517601   1/1  lsgillalsepsreallealelakeagvlvsfdpnyrpalwsleearelllellpladilkpneeEaell
00517411   1/1  yllallpaeallallelakeagvpvvlDpngr.pllwellpladlltpneeEaaaltgleildeedleea
00502481   1/1  ilp...ilallelareagvpvvlDpnlrpalleellpladlltpneeEaelltglkildeedleeaaral
00460301   1/1  asaalsledidllllllaaaalilllggllllselpreallkalelakeagvlvvldpnprpilwrakel
00524201   1/1  vlsgyllalselsaeavlkalelakaa....vlDpnlraklwlveeareallellplrgadlltpneeEa
00525531   1/1  slpaelpleallellelakeagvpvvlDpsgrallwllellaladllkpNeeElealtglelldledlll
00445871   1/1  sgillallelsreallellelareagvkvsldpnlrlalwsveaarelllellaladllkpneeEaelll
00497421   1/1  gsllselsleavlellelaraagvpvvlDpvmraklwlyaeealealrellpladlltpneeEaelltgl
00502181   1/1  lggllpleailellklakeagvlvvlDpngrlrlwsdlllveaarelllellplvdilkpneeEaelltg
00517801   1/1  lvvsglalggvsleailellelakelgipvvlDpsglllvlleellkladvlklsleeklealtgleles
00405001   1/1  vltGylgsaeiveavaellkklkaknpgvpvvlDPvmadklllsggllvdeeavealreellpladiitP
00501931   1/1  davltGylgseepieavaealklakaagpdvpvvlDPVmgdngglylladealealreellpladlitPN
00477051   1/1  vktGllgsaeiieavaellkklpgvpvvlDPvmadasglllladealealleellpladlitPNltEaal
00498461   1/1  ligllgsaeaieavaellkaakgvpvvlDPvmadasglrllaeealaalleellpladvitPNltEaell
00465771   1/1  lvlgasp..lmaddleellelledadvlvigpGlllsesleailaalelakeagipvvlDpvglgalllr
00446611   1/1  igllgslaaeavlaaaelareagkpvvlDpvglgalgfrleallelllpladvltPNlgEaaaLlgleva
00479081   1/1  anvlasllpelmvlpledlleqleelleradalvigpglgrdeavlalleaaleagkpvvlDadalnlla
00518461   1/1  vigpGllrseeaielvaellkeagvpvvlDadalnalalllelllpkatvltPNlgElarLlglsiddve


                         -         -         -         +         -         -         -:280
query           DQGINNVIITLGKQGAYYKTKDGVCELVPAFKVKAIDTTAAGDTFIGALVSKLDTSFSNLREAIIYASKA
00527841   1/1  llelgvklvvvtlGaeGallltggggevlhvpapkvevvdttGAGDafaagflagllllagls.leealr
00463321   1/1  lvdilkpneeEaaaltglt..dleeaaealllllelllllllllelleklarkllelgvklvvvtlGadG
00432781   1/1  lelgvkvvvvtlGakgallyt.ggevlhvpapkvkvvdttGAGDafaagllaglaqgls.leealrlAna
00517601   1/1  lgle..dpeeaaaaalellllllellleallelgvklvvvTlGakgaallnllsglllt.ggevvhvpaf
00517411   1/1  arallalgvklvvvtlGaeGallatggg.vlhvpappvevvdttGAGDafaagflaglaqgls.leealr
00502481   1/1  lelgvklvvvtlGakGallvtggg.vlhvpappvkvvdttGAGDafaagflaglaqgls.leealrlAna
00460301   1/1  llellplvdilfpNeeEaealtgledleeedaeklllllaaaalllalgvklvvvtlGakGallvtgggv
00524201   1/1  ealtgl.....ddleeaakkllelg.klvvvtlGekGallyt.ggevlhvpapkvkvvdttGAGDafaag
00525531   1/1  aaaaklllalgvklvvvtlGadGallvtgge.vlhvpapkvevvdttGAGDafaAgllygllkgld.lee
00445871   1/1  gltdle..........llalgvklvvvtlGakGallvt.ggevlhvpafpvkvvDttGAGDafaAgflag
00497421   1/1  e.....dleeaarallelgvklvvvtlGadgallvtgggvl.hvpapkvevvdttGAGDafaagllagll
00502181   1/1  l.....edleeaakkllelgaklvvvtlGe.Gallfdge..vyeipafkvevvDttGAGDafaAgflagl
00517801   1/1  ledpeeaaaelaklgv.vvvvTlGskgalvvdggkvilvlpapkvevvdttGAGDaFlagllyglvlqgl
00405001   1/1  NlfEaelLtgikindeedlkeaarkllelgakaVlitgghlgallvddlllldgslllvlllleggevfl
00501931   1/1  ltEaelltglkitsledlveaaraLlelgvkaVlvtgghllsldgdligallvtgdg.vlllpaprvevl
00477051   1/1  LlglpvieteedllaaarallelgakaVlvtgghlegdlvgdllvdgdg.vlllpaprvevvdttGaGDt
00498461   1/1  tglpitsledlleaarallalgakaVvvtggalggdllvalladggg.vvrvpaprvevvdttGaGDtfa
00465771   1/1  eelleallelllpdiitPNegEaerltglkllllkgvdsildledlleaakalaklggkvvvlt.Gakg.
00446611   1/1  lkgvdsleesledlleaaralaelgaavvvvt.Gahdvia..dggevlvvpagkvllvdttGaGDtlaaa
00479081   1/1  erllplatvltPnlgEaarLlglsvddvledrleaaralaalggavvllk.Gahd.liatdggrv.yvna
00518461   1/1  drleaarelaekggavvvlk.Gahd.liadgdg..vlvnatgnpalatgGtGDvlagiiaallaqgl.dl


                         -         *         -         -         -         -         +:350
query           SSLAVQRLGAIPSIPYKDDVEKQLNSK-------------------------------------------
00527841   1/1  lAnaaAalvvtrlGaipslptleel---------------------------------------------
00463321   1/1  allvtgggvvlllelllhv---------------------------------------------------
00432781   1/1  aaalavtrlGaipslptleeleelleev------------------------------------------
00517601   1/1  kvkvvDttGAGDaFaagllaglleg---------------------------------------------
00517411   1/1  lAnaaaalavtrlg....lptleele--------------------------------------------
00502481   1/1  aaalavtrlGaipglptleeleellke-------------------------------------------
00460301   1/1  lhvpvvpappvkvvDttGA---------------------------------------------------
00524201   1/1  flagllkgls.leealrlAnaaAalvv-------------------------------------------
00525531   1/1  alrlAnaaaalavtklGaqpslptl---------------------------------------------
00445871   1/1  llagls.leealrfAnaaAalvvtr---------------------------------------------
00497421   1/1  llkglslelleealrlAnaaaalav---------------------------------------------
00502181   1/1  llkgldleealrfAsaaaalv-------------------------------------------------
00517801   1/1  .slvealrfAaaaAalavtqlga..g--------------------------------------------
00405001   1/1  vpaprvevvdttGaGDtfaaa-------------------------------------------------
00501931   1/1  vvdtvGaGDtfaaalaaalakgls.---------------------------------------------
00477051   1/1  lsaalaaalaqgls.leeavrlAvaava------------------------------------------
00498461   1/1  aalaaalaqgls.leeavrlAv------------------------------------------------
00465771   1/1  llvdggevl.v-----------------------------------------------------------
00446611   1/1  iaaflaqg..dllea-------------------------------------------------------
00479081   1/1  tgnpalatgGaGDvL-------------------------------------------------------
00518461   1/1  leaaalAvalhglaaelaaelgpg----------------------------------------------