[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for lsal0:ABD99260.1


[Show Plain Result]

## Summary of Sequence Search
   1::146
   1::140  1.3e-26 22.6% 0047585 00475851 1/1   ed helix" DNA-binding domain            
   6::147  4.6e-26 23.7% 0040517 00405171 1/1   ed helix" DNA-binding domain            
   1::142  5.8e-26 25.2% 0040586 00405861 1/1   ed helix" DNA-binding domain            
   1::144  2.4e-25 24.3% 0053037 00530371 1/1   ed helix" DNA-binding domain            
   1::144  3.2e-25 23.4% 0052644 00526441 1/1   ed helix" DNA-binding domain            
   5::146    1e-24 23.0% 0051708 00517081 1/1   ed helix" DNA-binding domain            
   3::145  1.5e-24 25.0% 0052514 00525141 1/1   ed helix" DNA-binding domain            
   5::143  2.7e-24 25.0% 0052641 00526411 1/1   ed helix" DNA-binding domain            
   2::143  3.5e-24 24.1% 0051528 00515281 1/1   ed helix" DNA-binding domain            
   1::145    5e-24 23.2% 0052801 00528011 1/1   ed helix" DNA-binding domain            
   1::145    9e-24 24.5% 0049308 00493081 1/1   ed helix" DNA-binding domain            
   7::145  1.3e-22 25.7% 0052640 00526401 1/1   ed helix" DNA-binding domain            
   1::126    2e-22 26.0% 0042156 00421561 1/1   ed helix" DNA-binding domain            
  31::138  6.8e-22 23.6% 0041905 00419051 1/1   ed helix" DNA-binding domain            
   9::143  5.7e-21 21.2% 0040266 00402661 1/1   ed helix" DNA-binding domain            
   2::117  7.5e-20 21.2% 0037861 00378611 1/1   ed helix" DNA-binding domain            
   1::139    3e-19 25.6% 0048695 00486951 1/1   ed helix" DNA-binding domain            
   3::118  1.5e-18 23.0% 0038701 00387011 1/1   ed helix" DNA-binding domain            
  32::124  4.6e-17 25.6% 0043935 00439351 1/1   ed helix" DNA-binding domain            
  32::140  4.7e-17 26.2% 0049363 00493631 1/1   ed helix" DNA-binding domain            
  35::124  2.2e-13 22.2% 0052364 00523641 1/1   ed helix" DNA-binding domain            
  35::127  2.6e-12 22.8% 0049384 00493841 1/1   ed helix" DNA-binding domain            
  40::127  1.2e-11 24.1% 0051444 00514441 1/1   ed helix" DNA-binding domain            
  31::124  1.5e-11 23.7% 0051024 00510241 1/1   ed helix" DNA-binding domain            
  21::126    3e-11 23.8% 0051521 00515211 1/1   ed helix" DNA-binding domain            
  22::121  4.1e-11 24.0% 0044258 00442581 1/1   ed helix" DNA-binding domain            
  40::128  7.9e-11 21.8% 0052579 00525791 1/1   ed helix" DNA-binding domain            
  40::119    3e-08 19.0% 0052755 00527551 1/1   ed helix" DNA-binding domain            
  28::132  9.5e-07 22.1% 0052506 00525061 1/1   ed helix" DNA-binding domain            
  29::108  2.9e-06 21.8% 0048703 00487031 1/1   ed helix" DNA-binding domain            
  33::92   4.9e-06 20.0% 0051507 00515071 1/1   ed helix" DNA-binding domain            
  36::115  9.5e-06 16.4% 0043164 00431641 1/1   ed helix" DNA-binding domain            
  43::140    1e-05 22.3% 0053261 00532611 1/1   ed helix" DNA-binding domain            
  22::86   0.00034 20.0% 0042770 00427701 1/1   ed helix" DNA-binding domain            
  33::95   0.00044 22.2% 0052159 00521591 1/1   ed helix" DNA-binding domain            
  35::94   0.00062 21.7% 0047283 00472831 1/1   ed helix" DNA-binding domain            
   1::146


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MDERYQVINDALEKIYADIVWIEESELRKSVFSDITIKEMHAINAISMYDHQTASQVAKKLHLTPGTLTA
00475851   1/1  lldlelelllllrrlarallrlldellkel...gltpaqflvLlaLaenggltvseLaerlglskstvtr
00405171   1/1  -----eqllfllrraarlllrlldellke...lgltltqfrvLllLaenggltvseLaerlglsrstvtr
00405861   1/1  mdeldeellfllrralrlllrlllldellke...lgltlaqfliLllLaenggltvseLaerlglskstl
00530371   1/1  mldlelellfllrrlaralrrlldellkel...gltpaqfrvLlaLaelggpltvseLaerlglskstvt
00526441   1/1  lslsleslllldlldlllldlldmedpdldelelellfllrrlaralrrlldellkel...gltpaqfrv
00517081   1/1  ----deellfllrrlarallrlldellke...lgltpaqflvLlaLaenggltvseLaerlgiskstvtr
00525141   1/1  --dldlellfllrrlarallrlldellk...elgltpaqflvLlaLaelggltvseLaerlglskstvtr
00526411   1/1  ----edqllfllrraarallrlldellke...lgltlaqfrvLllLaenggltvseLaerlglskstltr
00515281   1/1  -mdlelellfllrrlarallrlldellke...lgltpaqflvLlaLaenggltvseLaerlglskstltr
00528011   1/1  mdldlpdllllelellfllrrlaralrrlldellke...lgltpaqfrvLlaLaenggltvseLaerlgl
00493081   1/1  dlldlelqllfllrrlaralrrlldellk...elgltpaqfrvLlaLaenggltvseLaerlglskstvt
00526401   1/1  ------sllfllrrlarallrlldellke...lgltpaqflvLlaLaelnggltqseLaerlglskstvt
00421561   1/1  mdelllellflllraarallrllekllk...elgltltqlliLllLaeaeeggltvkelaeklglskstv
00419051   1/1  ------------------------------kelgltplelevllvLwekgpltvkelaeelgeeldlsps
00402661   1/1  --------iflllraarllikllgellk...rlglsptrlriLalLaesdgpltvselaeelglskstvs
00378611   1/1  -melelellllllrlarlllrlldkllke...lgltltqflvLllLaendeggltlkdlaellniskstv
00486951   1/1  sdlldlelllllllrraarlllrlldealg......ltlaqfrvLlaLaelggglltvseLaerlglsks
00387011   1/1  --elelellflllrllrlllrlldkllke...lgltltqllvLllLaeeggelltvseLaerlglskstv
00439351   1/1  -------------------------------glgltplqlliLllLaegpgltvyelaerlggllslspg
00493631   1/1  -------------------------------mlkLtelelevllvlwelgpitvkeiaeeleekrglsys
00523641   1/1  ----------------------------------raaraliellaellkalgldptrlriLllLlengep
00493841   1/1  ----------------------------------llrllleelaellkalgldptrlriLllLlengglt
00514441   1/1  ---------------------------------------lmllldlllllcpvaraldllgdkwrlliLr
00510241   1/1  ------------------------------kelllgllqlliLalLae.gplygyelaklleellggllg
00515211   1/1  --------------------lllellcpvalaldllgdkwrlliLrlll.egplrfseLarllpgisqgt
00442581   1/1  ---------------------mdrlllalllkalldptrlliLllLaedgeltvseLaellglspstlsr
00525791   1/1  ---------------------------------------lliLrlll.egplrfgeLarrlgiskstLsr
00527551   1/1  ---------------------------------------lliLrlll.ngplrfseLaralpgisqktls
00525061   1/1  ---------------------------rivlelllgklrlliLalLae.gplhgyeLakrleelslgllp
00487031   1/1  ----------------------------llkllklseleleilrlLwklgpltvkeiaeeleeelglsps
00515071   1/1  --------------------------------llldlnqllvlrllrengplsraeLarllglspatvtr
00431641   1/1  -----------------------------------srtrlliLllLlealegelsftelaealglsqstv
00532611   1/1  ------------------------------------------mmedlarllkaLgdptrlrILrlLl.eg
00427701   1/1  ---------------------lssalgelslsrdleqrvlellrelgegkaltakeLakelgvskstvnr
00521591   1/1  --------------------------------leLdeldlkilellakdprlslrelaerlGlsegtvsr
00472831   1/1  ----------------------------------ldeleleilllllengplsiselaerlglskstvsr


                         -         -         *         -         -         -         -:140
query           TIDRLCRKGYAERIRGNDDRRIIRIGLTKKGRLVYRAHDAFHRMMVKSFLKDLNPDEIKTIEKAIHNLED
00475851   1/1  lldrLekkGlvererdpeDrRavllslTekGrelleellellleelleellaglseeeleallrllekll
00405171   1/1  llkrLeekGlvererdpedrRavllsLTekGrelleellelheelleelleglseeeleallrlleklld
00405861   1/1  trllkrLekkglvererdpeDrRvvllsLTekGrelleellalleelleellaglseeeleallrllekl
00530371   1/1  rllkrLekkGlvererdpeDrRrvllslTekGrelleellelleelleellagvlseeeleallralell
00526441   1/1  LlaLaenggggyltvseLaerlglskstvsrllkrLekkGlvererdpeDrRrvlvsLTekGrelleell
00517081   1/1  llkrLekkGlverepdpeDrRrvllslTekGrelleellalleelleellaglseeeleallrlleklld
00525141   1/1  lldrLekkGlvererdpeDrRvvllslTekGrelleellalleelleellaglseeeleallrlleklld
00526411   1/1  lldrLekkGlvererdpeDrRrvllsLTekGrelleellalllelleellaglseeeleallrlleklld
00515281   1/1  llkrLekkGlvererdpeDrRvvllsLTekGrelleellelleelle..laglseeeleallrlleklld
00528011   1/1  skstvtrlldrLekkGlvererdpeDrRvvllsLTekGrelleellelleelleellaglseeerleall
00493081   1/1  rlldrLekkGlvererdpeDrRavllsLTekGrelleellelllelleellaglseeeleallrllekll
00526401   1/1  rlldrLekkGlvererdpeDrRavllsLTekGrelleellalllelleellaglseeeleallrllekll
00421561   1/1  trllkrLekkglvervrspeDrRvvllsLTekgrelleellelleellkellsgls--------------
00419051   1/1  tvttllkrLekkGlverekd..grrvvyysltekgeellellkelleelfegllelllaallddegls--
00402661   1/1  ralkrLeelGlvrrerspgdrrrvyysltekglillflerlrellekllelleelleellsglsdeeler
00378611   1/1  trllkrLekkglverkrseeDrRvvllslTekGrelleellelleel-----------------------
00486951   1/1  tvtrlldrLekkglvererdpeDrRavllslTekGrelleellalleellee............leqll-
00387011   1/1  trllkrLekkglvererspeDrRvvllslTekGrelleellelleell----------------------
00439351   1/1  tvyrllkrLekeGlverrr...drrrkyyslTekGkelleellelleellelll----------------
00493631   1/1  tvttllkrLekkglvereks..grryvyipltekgeyllkelkelldklfdgslkslvaalleeeklsee
00523641   1/1  ltvseLaellglskstvsrhlkkLeeaGlverrrsegdgrkvyysltekgrell----------------
00493841   1/1  vseLaeelglsrstvsrrlkrLeeaGlvererapldgrkvgysltekg.elleelle-------------
00514441   1/1  lll.dgplrfseLarrlpgisqstlsrrLkrLeedGlverrvypedprrveysLTek-------------
00510241   1/1  isegtlypaLkrLekkglveryleesegdrrrkyyrlTekGrelleelleelee----------------
00515211   1/1  ltrrLkrLeedGlverevypedprrveysLTekGrallpvllallewgeehlleil--------------
00442581   1/1  hLkrLeeaGlverrrdpedgrrvyysltekgrelleallelleelleelld-------------------
00525791   1/1  rLkrLeeaGlver.vypedprrveYrLTekGrallpvllalaewgeehlaelleaeer------------
00527551   1/1  rrLkeLeedglverrvypedpprveYsLTelGrellpvllallewgeeh---------------------
00525061   1/1  gispgtlypaLkrLeedGlverevepsdgprrkyYrlTeaGrelleellalleelleallel--------
00487031   1/1  tvstlLkrLeekglverek..egrayiYsalvskeeyl--------------------------------
00515071   1/1  ivdeLeeaglveevgdpedgrr------------------------------------------------
00431641   1/1  srhlkkLeelglver.....egk..yysLTekGeellellrelle-------------------------
00532611   1/1  pltvseLaeelgisqstvsrhLkkLeeaGlverrrepedrggrrvyYrltekglallldllaelaealle
00427701   1/1  aLysLereglvvregg------------------------------------------------------
00521591   1/1  rlerLeekGlvervvvlvdrrklgy---------------------------------------------
00472831   1/1  hlkkLeeagliervgllldrrklg----------------------------------------------


                         +         -         -         -         -         *         -:210
query           FLKEHS----------------------------------------------------------------
00475851   1/1  ----------------------------------------------------------------------
00405171   1/1  nleelid---------------------------------------------------------------
00405861   1/1  le--------------------------------------------------------------------
00530371   1/1  ekll------------------------------------------------------------------
00526441   1/1  elle------------------------------------------------------------------
00517081   1/1  nleele----------------------------------------------------------------
00525141   1/1  nleel-----------------------------------------------------------------
00526411   1/1  nle-------------------------------------------------------------------
00515281   1/1  nle-------------------------------------------------------------------
00528011   1/1  rllek-----------------------------------------------------------------
00493081   1/1  dnlde-----------------------------------------------------------------
00526401   1/1  dnlee-----------------------------------------------------------------
00421561   1/1  ----------------------------------------------------------------------
00419051   1/1  ----------------------------------------------------------------------
00402661   1/1  lle-------------------------------------------------------------------
00378611   1/1  ----------------------------------------------------------------------
00486951   1/1  ----------------------------------------------------------------------
00387011   1/1  ----------------------------------------------------------------------
00439351   1/1  ----------------------------------------------------------------------
00493631   1/1  ----------------------------------------------------------------------
00523641   1/1  ----------------------------------------------------------------------
00493841   1/1  ----------------------------------------------------------------------
00514441   1/1  ----------------------------------------------------------------------
00510241   1/1  ----------------------------------------------------------------------
00515211   1/1  ----------------------------------------------------------------------
00442581   1/1  ----------------------------------------------------------------------
00525791   1/1  ----------------------------------------------------------------------
00527551   1/1  ----------------------------------------------------------------------
00525061   1/1  ----------------------------------------------------------------------
00487031   1/1  ----------------------------------------------------------------------
00515071   1/1  ----------------------------------------------------------------------
00431641   1/1  ----------------------------------------------------------------------
00532611   1/1  ----------------------------------------------------------------------
00427701   1/1  ----------------------------------------------------------------------
00521591   1/1  ----------------------------------------------------------------------
00472831   1/1  ----------------------------------------------------------------------