[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for lsal0:ABD99261.1


[Show Plain Result]

## Summary of Sequence Search
   1::326
   1::326  3.8e-52 27.4% 0049604 00496041 1/1   ase-like                                
   1::171  9.9e-44 34.7% 0049764 00497641 1/2   ase-like                                
   2::172    5e-43 39.4% 0036930 00369301 1/1   ase-like                                
   2::174    1e-42 37.0% 0047209 00472091 1/1   ase-like                                
   2::178  2.6e-42 36.2% 0049762 00497621 1/1   ase-like                                
   3::171    1e-41 43.9% 0049717 00497171 1/1   ase-like                                
   4::175    2e-41 40.4% 0044256 00442561 1/1   ase-like                                
   1::171    3e-39 38.2% 0035563 00355631 1/1   ase-like                                
 177::326  7.1e-39 42.7% 0047210 00472101 1/1   ase-like                                
   4::170    1e-36 35.5% 0044181 00441811 1/2   ase-like                                
 185::326  2.3e-35 40.1% 0044182 00441821 1/1   ase-like                                
   1::174  1.1e-34 31.6% 0041153 00411531 1/2   ase-like                                
 157::326    2e-34 41.1% 0036931 00369311 1/1   ase-like                                
 173::326  8.1e-34 39.0% 0035564 00355641 1/1   ase-like                                
 152::326  1.1e-33 41.1% 0044257 00442571 1/1   ase-like                                
 152::326  2.9e-33 43.5% 0041154 00411541 1/1   ase-like                                
 198::326  1.4e-32 38.8% 0049763 00497631 1/1   ase-like                                
  31::302  3.7e-32 26.4% 0049939 00499391 1/1   ase-like                                
   1::174  8.7e-32 28.7% 0038812 00388121 1/2   ase-like                                
  31::298  1.1e-30 25.6% 0048944 00489441 1/1   ase-like                                
 152::326  2.5e-30 38.8% 0038813 00388131 1/1   ase-like                                
 212::326  1.1e-19 27.0% 0049718 00497181 1/1   ase-like                                
 202::326  3.8e-18 29.6% 0044181 00441812 2/2   ase-like                                
   1::171  6.7e-14 20.0% 0039353 00393531 1/1   ase-like                                
 214::304    6e-09 25.6% 0038812 00388122 2/2   ase-like                                
   1::171  3.5e-08 20.0% 0036364 00363641 1/1   ase-like                                
   2::160    1e-06 18.2% 0044093 00440931 1/1   ase-like                                
 203::324  1.3e-06 24.1% 0035033 00350331 1/1   ase-like                                
  19::143  5.3e-06 20.0% 0035032 00350321 1/1   ase-like                                
   1::171  5.2e-05 19.4% 0042062 00420621 1/1   ase-like                                
 202::327   0.0002 20.5% 0042745 00427451 1/1   ase-like                                
 214::288     0.14 21.6% 0041153 00411532 2/2   ase-like                                
 208::304      4.5 17.7% 0049764 00497642 2/2   ase-like                                
   1::326


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MENIEISYTARYVPPEVIDNQRLTEFMDTSDEWISQRTGIKKRHISLNESTADLAKKVAEKLLTKSGWNP
00496041   1/1  lllelsrdepvaivegmgcrfPglavsleefwelllegrdaiseipavrilllgsylpdryvtnggl...
00497641   1/2  llrrpmpvyilgigtalPervvtneelaellgtltdslldeellellerilertgikeRhvalpeetllp
00369301   1/1  -gpvyilgigtalPenvvtneelaelldtstkftdllelleflerilertgigerhialpdeillpppsl
00472091   1/1  -epvgIlgigvylPelvvtneelaellgtsderilartgikerrvalpdedasdlaleAareaLedagld
00497621   1/1  -sllllllllradepvaivgigtalPggvvsqeelldllaeltdalslvplkrllkrildgsgipkryvv
00497171   1/1  --nvgIlgigvylPelvvtneelaellgtsdekilertgikerrvalpdedasdlaveAarkale..gid
00442561   1/1  ---vvIlglgsylPegvvtneeleklldtsdewilartgilerrialkdettsdlalaaarealedagld
00355631   1/1  MlvllliryalrapgpvyilgigtalPplvvtneelaelldtvtlllldlelleflerilertgikertl
00472101   1/1  ----------------------------------------------------------------------
00441811   1/2  ---vyilgigtylPprvvtneelaellgilsfllgsdgklerilertgigsrtialpeeilltdplltmr
00441821   1/1  ----------------------------------------------------------------------
00411531   1/2  llllllmrpvaIvgigvylPggvvsneelwellgtsdefiavrtgigerrgaladepavdlaleaareal
00369311   1/1  ----------------------------------------------------------------------
00355641   1/1  ----------------------------------------------------------------------
00442571   1/1  ----------------------------------------------------------------------
00411541   1/1  ----------------------------------------------------------------------
00497631   1/1  ----------------------------------------------------------------------
00499391   1/1  ------------------------------dvvivgaartpigkrrgaladvsasdLaaeaarealerag
00388121   1/2  mslllllllmrrvvivgigvylPlgvvtneeladllggssgkilertgigsrrgalvferavdlaaeaar
00489441   1/1  ------------------------------dvvivdaartpigkrrgaladdpaadlaaeaarealerag
00388131   1/1  ----------------------------------------------------------------------
00497181   1/1  ----------------------------------------------------------------------
00441812   2/2  ----------------------------------------------------------------------
00393531   1/1  mervaIvgmgvrtPggv.glgelwdlllagrsgireipafrldglyvrvggfldfdaaffisprearamd
00388122   2/2  ----------------------------------------------------------------------
00363641   1/1  mervaivgmgvrtPgg.lsleelwdlllagrsgireipafrldglyvrvagfldfdaaffisprearamd
00440931   1/1  -ervaIvGmgvrtPggngleefwelllagrsgireipafrldrfggflagvvpfdaaffgisprearamd
00350331   1/1  ----------------------------------------------------------------------
00350321   1/1  ------------------lllllggfmddvvivgfdrtpfgksprgalamdpaqdlaleaarealedapl
00420621   1/1  eslldlmmepvaIvgmgvrtPgg.lgleefwelllagrsgireipafrldglyvrvggflddfdaffgis
00427451   1/1  ----------------------------------------------------------------------
00411532   2/2  ----------------------------------------------------------------------
00497642   2/2  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           NSLDLIIVATMSPNSFTPATAAIVQGRISADNAVCFDISAACSGYIYGLSIVEAMLRNMNLKRAMLIGSE
00496041   1/1  lddvdefdaartgispreaalmdeaqrlaleaarealedagldpedidgvivgtvt.gallpslaarval
00497641   1/2  dpllllpllpsleerldialeeavdlaveAarkaLeeagldpsdidllivatstgd.atpslaallanll
00369301   1/1  fdlllpslserlalaleeavdlaveAarkaledagldpsdidllivatstgdd.tpslaalvanllglrg
00472091   1/1  pddidlvivgtvtgdyllpslaarvaallglrgapafdvnaaCasglaALalAaqlirsgladraLvvga
00497621   1/1  ldelfllldtsldwilertgiserraaaldeaadlaleAarkaLeragidpsdidllivatstgd.llps
00497171   1/1  psdidllivatespddllpstaalvqnllglspnalafdlnaaCsgglaalrlAadliesgpakrvLvvg
00442561   1/1  pedidlvivgtvtpdyllpataalvalrlgl.ngpafdvnaaCasglyAlalAaalirsgladvvLvgga
00355631   1/1  vlpeeilledpelfllllpslgerlalaleeavdlaveAarkaleragidpsdidlvivatstgdd.tps
00472101   1/1  ----------------------------------------------------------------------
00441811   1/2  grevfeeavelaaeaarealeeagldpedidllivatstgdl.tphqanllikrlglppdvvafdlgntg
00441821   1/1  ----------------------------------------------------------------------
00411531   1/2  edagldpedidgvivgtvtgdyalpslaarvalllglpgvpafdvdtaCasglaalalAadlirsgeadv
00369311   1/1  ----------------------------------------------------------------------
00355641   1/1  ----------------------------------------------------------------------
00442571   1/1  ----------------------------------------------------------------------
00411541   1/1  ----------------------------------------------------------------------
00497631   1/1  ----------------------------------------------------------------------
00499391   1/1  ldpedidlvivGtvlpdglqgpnlarlaalalglplgvpaftvnraCsSglvAlhlAaqairsGeadvvl
00388121   1/2  ealedagldpedidgvivgtatggilgpslaaavalrlglpgvpavtvstaCasglaalplAadlirsgr
00489441   1/1  ldpedvddvivGvvlgagqgpniarrvalalglpvggpaftvnraCaSglqAialAaqairsGeadvvla
00388131   1/1  ----------------------------------------------------------------------
00497181   1/1  ----------------------------------------------------------------------
00441812   2/2  ----------------------------------------------------------------------
00393531   1/1  pqqrlaleaareAledagldpedldgvrvGvvvgsglggylarlaallaglprgprrvspylltgtllnv
00388122   2/2  ----------------------------------------------------------------------
00363641   1/1  pqqrlaleaarealedagldpeelddgsrtGvivGsvlggylllnlarlaallaglpesvspylltglll
00440931   1/1  pqqrlaleaareAledagldpeeldgvrvGvvvgsglggylaleaallallpkglllellprrvspyllt
00350331   1/1  ----------------------------------------------------------------------
00350321   1/1  slgldpeevddvivGvvlgaglggniarraallaglpvsgpaltvntaCsSglvAihlAaqairaGeadv
00420621   1/1  prearamdpqqrlaleaawealedagldpeeldgvrvGvvvgsglggylarlaallaglpkgpelvspyl
00427451   1/1  ----------------------------------------------------------------------
00411532   2/2  ----------------------------------------------------------------------
00497642   2/2  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           NLSKLIDWNDRSTAVLFGDGAAGALIELKEDTDSKFISSDLKTIGNEAEFLTAGITDPLEKFPDLDSIRK
00496041   1/1  llglppngpaftvdtagCssglvAlhlAaqlirsgeadvaLvggvelmsraldpegfaslvalsalfgdg
00497641   1/2  glrpdvrafdlggmgCsaglaaLrlAkdlle---------------------------------------
00369301   1/1  dvaraflvgagCsgglaaLdlAkdlleagpga--------------------------------------
00472091   1/1  ellslgldfddrltgalfgdGAaavvlerdeeeg------------------------------------
00497621   1/1  laarvanllglrgnvvafdlagaGCsgglvaLrlAadl--------------------------------
00497171   1/1  aeilsllldlgdr...vlfGdGAaAvllgad---------------------------------------
00442561   1/1  ealsrlldfddrrtgflfGdGAgavvLeeleedsg-----------------------------------
00355631   1/1  laalvanllglrgdvrafdlngmgCsaglaa---------------------------------------
00472101   1/1  ------------------------------------lgtallsdgsgadlltldaggfrrp.......dg
00441811   1/2  casgplALdlaadllragpgdrvlvvgaEl----------------------------------------
00441821   1/1  --------------------------------------------kpllellaagslllpdsedligldlr
00411531   1/2  vLvvgvelmsrprdfddaadgslfgdGAaavvle------------------------------------
00369311   1/1  ----------------FGdGAaAvllgadp............lllpdgegallllldedg..........
00355641   1/1  --------------------------------lfgilstalgadgdsedlltldlde.............
00442571   1/1  -----------gnaslfgdGAaAvllesdeg..aralglrplarg.........................
00411541   1/1  -----------gnaslfgDGAaAvvleseeda.rglgllplatig.........................
00497631   1/1  ---------------------------------------------------------Pllelvralstll
00499391   1/1  agGvesmsrvpllldr...alfgdgagavllf...daladgl............llaeglgdpvlkrlmg
00388121   1/2  advvlvvgaeamslprdfddardgslfgdGAaal------------------------------------
00489441   1/1  gGvesmsrapllldrrtgalfgdgarafdlea....dglvlgegaglmgltaeelalrygisredqdafa
00388131   1/1  -----------gdgflfgdGAaavvLesleaaralglrilaviv..........................
00497181   1/1  ----------------------------------------------------------------------
00441812   2/2  -------------------------------------------------------------alpeeillt
00393531   1/1  lagrisyllgltgpaltvdtacsSglvAlhl---------------------------------------
00388122   2/2  ----------------------------------------------------------------------
00363641   1/1  nvlagrvsyllglrGpaltvdtacaSslvAi---------------------------------------
00440931   1/1  gtlpnvlagrvsyllglrgp--------------------------------------------------
00350331   1/1  --------------------------------------------------------------rglkplar
00350321   1/1  alA-------------------------------------------------------------------
00420621   1/1  ltgtllnvlagrvsyllglrgpaltvdtacs---------------------------------------
00427451   1/1  -------------------------------------------------------------lkplarivg
00411532   2/2  ----------------------------------------------------------------------
00497642   2/2  -------------------------------------------------------------------lpl


                         -         -         -         +         -         -         -:280
query           YTTFKMDGRRVYTFATREVPQSILRAVQKANLSLEDIDYFILHQANSRIIRQVAKKLKQDEEKFPINIDS
00496041   1/1  acavfltaadgsvlgegagavvlkslsdalrdgdrilavirgsavngd....................gl
00497641   1/2  ----------------------------------------------------------------------
00369301   1/1  ----------------------------------------------------------------------
00472091   1/1  ----------------------------------------------------------------------
00497621   1/1  ----------------------------------------------------------------------
00497171   1/1  ----------------------------------------------------------------------
00442561   1/1  ----------------------------------------------------------------------
00355631   1/1  ----------------------------------------------------------------------
00472101   1/1  glllvmdgrevfklavklvpeaikellekaglsledidlfvphqanrrildavakklglppekvrvvlde
00441811   1/2  ----------------------------------------------------------------------
00441821   1/1  dtgltmvgrkvfplavklvapalkellekaglsledidlfvpHqanarildavakklglppekvvasrgv
00411531   1/2  ----------------------------------------------------------------------
00369311   1/1  ..llvmlgrevfklavkalaevlkellekaglslddidffvlHqagrrildavakkLglpeekvlasrav
00355641   1/1  dgllvmlgrevfklavdalpkvlkellekaglslddidffvpHqanrrildavakkLglppekvvasrdv
00442571   1/1  ..llvalgrdvpklaltalveairealekagltpddidlfvlhqanaaildavakklglppekvrvnlhp
00411541   1/1  ..llamlgrdvpklavaalvpairkalekagltlddidlfvlhqagarildavakklglppekvnvlgli
00497631   1/1  pdsedaigldlddlgllvmlgkevpklavkalpklleellekaglsledidffvlHpggrrildavekkL
00499391   1/1  ataenvaekygisreeqdafavkshrraaaaikaglfkaeivpvdvpdrkgdvvvahdegirigttlekl
00388121   1/2  ----------------------------------------------------------------------
00489441   1/1  lrshiraaaagaagffdgeivpvtvpdgkgqarvirdalaragltledldylkpvfanhgtvtagn....
00388131   1/1  ..glamdgrevpapavealaeairkalekagltpddidyvelhqagtrildavekklglppekvkvntgh
00497181   1/1  -eypvvdgklslkcyldaldeaykeylekaglslddfdylvfHqPftklvlkalrrllltlleaiaelle
00441812   2/2  dplltmrgrevfeeavelaaeaarealeeagldpedidllivatstgdltphqanlli.....krlglpp
00393531   1/1  ----------------------------------------------------------------------
00388122   2/2  ---mslllllllmrrvvivgigvylPlgvvtneeladllggssgkilertgigsrrgalvferavdlaae
00363641   1/1  ----------------------------------------------------------------------
00440931   1/1  ----------------------------------------------------------------------
00350331   1/1  ivgyavagdd.palmglgpvlAirkalekaglspddidlielheafaaqvlaalealgldle..kvnvsG
00350321   1/1  ----------------------------------------------------------------------
00420621   1/1  ----------------------------------------------------------------------
00427451   1/1  yavagda....palmglgpvlAirkaleraglspddidlvelheaftaqdlaelealglgrlpvnvsGga
00411532   2/2  ---llllllmrpvaIvgigvylPggvvsneelwellgtsdefiavrtgigerrgaladepavdlaleaar
00497642   2/2  lpsleerldialeeavdlaveAarkaLeeagldpsdidllivatstgd.atpslaallanllglrpdvra


                         -         *         -         -         -         -         +:350
query           FGNTSAASEPLLLDELIENGTVKRGMTLALSGFGGGLTVGTHIIKY------------------------
00496041   1/1  gkgvpapagegqarairkaleragldpddidyveahgtgtalgdai------------------------
00497641   1/2  ----------------------------------------------------------------------
00369301   1/1  ----------------------------------------------------------------------
00472091   1/1  ----------------------------------------------------------------------
00497621   1/1  ----------------------------------------------------------------------
00497171   1/1  ----------------------------------------------------------------------
00442561   1/1  ----------------------------------------------------------------------
00355631   1/1  ----------------------------------------------------------------------
00472101   1/1  yGNtssasiplaLdelleegrlkpGdrvlllafGaGltwgaallrv------------------------
00441811   1/2  ----------------------------------------------------------------------
00441821   1/1  laeyGNtssAsiplaLdellekgrlkkgdrvlllafGpGltwgaal------------------------
00411531   1/2  ----------------------------------------------------------------------
00369311   1/1  LaeyGNtssasvplaLdellrkgleeglltrlkggdlvlllafGaG------------------------
00355641   1/1  LaeyGNtssasiplaLdellrkgleeglatrlkkgdlvlllafGpG------------------------
00442571   1/1  yGntgaasiplalaellrrgrlkpgdrvlllafGsGltagaavlrv------------------------
00411541   1/1  ayGntssAsiplalaellregrlkggdlglllafGaGltvaaavlr------------------------
00497631   1/1  glppekllasrevlreyGNtssasvplvLdellrkgrleglattgk------------------------
00499391   1/1  lklkpvfvpdgtvtagnasgis------------------------------------------------
00388121   1/2  ----------------------------------------------------------------------
00489441   1/1  ..........dslendGA----------------------------------------------------
00388131   1/1  plGntgaaslplallallregrlkpgdrvlllgfGaGltngalvle------------------------
00497181   1/1  ekvepsllylrrvGNtytaSlylaLasllengdllaGdrillfsyG------------------------
00441812   2/2  dvvafdl...gntgcasgplALdlaadllragpgdrvlvvgaElls------------------------
00393531   1/1  ----------------------------------------------------------------------
00388122   2/2  aarealedagldpedidgvivgta----------------------------------------------
00363641   1/1  ----------------------------------------------------------------------
00440931   1/1  ----------------------------------------------------------------------
00350331   1/1  galalGhplgasGarllvelllqL.rgg..alglavlciggGfg--------------------------
00350321   1/1  ----------------------------------------------------------------------
00420621   1/1  ----------------------------------------------------------------------
00427451   1/1  ialGhplgAsGarllvtlllalrgrggrralatlcggggqgaalvle-----------------------
00411532   2/2  ealedagl--------------------------------------------------------------
00497642   2/2  fdlggmgCsaglaaLrlAkdllea----------------------------------------------