[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for lsal0:ABD99303.1


[Show Plain Result]

## Summary of Sequence Search
   1::649
 245::535  3.1e-91 39.9% 0041634 00416341 1/1    II aaRS and biotin synthetases         
 244::541    2e-86 34.0% 0046638 00466381 1/1    II aaRS and biotin synthetases         
 221::557  3.3e-72 33.0% 0049378 00493781 1/1    II aaRS and biotin synthetases         
 233::541  1.6e-69 34.2% 0047165 00471651 1/1    II aaRS and biotin synthetases         
 241::541  2.1e-67 33.7% 0041422 00414221 1/1    II aaRS and biotin synthetases         
 239::541    2e-65 33.0% 0041426 00414261 1/1    II aaRS and biotin synthetases         
 259::543  1.3e-58 29.3% 0035005 00350051 1/1    II aaRS and biotin synthetases         
 257::550  9.8e-56 30.7% 0051519 00515191 1/1    II aaRS and biotin synthetases         
 235::553  1.6e-55 26.7% 0035194 00351941 1/1    II aaRS and biotin synthetases         
 259::510  3.6e-55 31.6% 0040152 00401521 1/1    II aaRS and biotin synthetases         
 260::553  2.5e-54 29.4% 0048934 00489341 1/1    II aaRS and biotin synthetases         
 257::543  3.5e-54 32.1% 0050706 00507061 1/1    II aaRS and biotin synthetases         
  65::243  3.7e-48 44.6% 0042737 00427371 1/1   /AlaRS common domain                    
 231::553  7.2e-48 28.1% 0035382 00353821 1/1    II aaRS and biotin synthetases         
 272::548  1.5e-47 30.9% 0049994 00499941 1/1    II aaRS and biotin synthetases         
  63::244  1.8e-47 40.2% 0041633 00416331 1/1   /AlaRS common domain                    
 538::644  5.6e-31 44.9% 0041420 00414201 1/1    II aaRS ABD-related                    
 542::648  7.2e-31 47.2% 0037214 00372141 1/1    II aaRS ABD-related                    
 538::648  1.4e-30 42.7% 0038521 00385211 1/1    II aaRS ABD-related                    
  67::229  3.8e-30 37.5% 0044651 00446511 1/1   /AlaRS common domain                    
 538::645  3.8e-30 43.0% 0041424 00414241 1/1    II aaRS ABD-related                    
 536::648  4.5e-30 41.6% 0041631 00416311 1/1    II aaRS ABD-related                    
 545::644  1.9e-28 40.4% 0035193 00351931 1/1    II aaRS ABD-related                    
 545::640  2.5e-27 45.7% 0042728 00427281 1/1    II aaRS ABD-related                    
 546::643  1.9e-25 42.3% 0050705 00507051 1/1    II aaRS ABD-related                    
 546::642  8.4e-21 32.3% 0040151 00401511 1/1    II aaRS ABD-related                    
 546::643  2.7e-20 32.3% 0035004 00350041 1/1    II aaRS ABD-related                    
 537::643  6.2e-20 29.0% 0037946 00379461 1/1    II aaRS ABD-related                    
 537::648  3.4e-18 26.8% 0052834 00528341 1/1    II aaRS ABD-related                    
   4::63     7e-18 58.3% 0048938 00489381 1/1   ike                                     
   4::62   1.7e-16 55.9% 0048468 00484681 1/1   ike                                     
 271::436  1.7e-15 23.5% 0037947 00379471 1/1    II aaRS and biotin synthetases         
 259::427  3.1e-15 22.3% 0042520 00425201 1/1    II aaRS and biotin synthetases         
 548::649  1.9e-14 26.7% 0044672 00446721 1/1    II aaRS ABD-related                    
 265::429  9.9e-11 29.2% 0046922 00469221 1/1    II aaRS and biotin synthetases         
 247::429  3.9e-10 21.0% 0042525 00425251 1/1    II aaRS and biotin synthetases         
 265::429    3e-07 24.5% 0046052 00460521 1/1    II aaRS and biotin synthetases         
 265::425  8.1e-05 26.6% 0046437 00464371 1/1    II aaRS and biotin synthetases         
 260::336  0.00067 29.9% 0048309 00483091 1/1    II aaRS and biotin synthetases         
   1::649


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MSSIKITFPDNSVKEFDAGVTTAEIAKSISISLAKKAVAGKVDGNFVDLNQPLKEDGSIEIITKDSNDGL
00416341   1/1  ----------------------------------------------------------------------
00466381   1/1  ----------------------------------------------------------------------
00493781   1/1  ----------------------------------------------------------------------
00471651   1/1  ----------------------------------------------------------------------
00414221   1/1  ----------------------------------------------------------------------
00414261   1/1  ----------------------------------------------------------------------
00350051   1/1  ----------------------------------------------------------------------
00515191   1/1  ----------------------------------------------------------------------
00351941   1/1  ----------------------------------------------------------------------
00401521   1/1  ----------------------------------------------------------------------
00489341   1/1  ----------------------------------------------------------------------
00507061   1/1  ----------------------------------------------------------------------
00427371   1/1  ----------------------------------------------------------------ddrrgl
00353821   1/1  ----------------------------------------------------------------------
00499941   1/1  ----------------------------------------------------------------------
00416331   1/1  --------------------------------------------------------------vdwdrrgl
00414201   1/1  ----------------------------------------------------------------------
00372141   1/1  ----------------------------------------------------------------------
00385211   1/1  ----------------------------------------------------------------------
00446511   1/1  ------------------------------------------------------------------rrll
00414241   1/1  ----------------------------------------------------------------------
00416311   1/1  ----------------------------------------------------------------------
00351931   1/1  ----------------------------------------------------------------------
00427281   1/1  ----------------------------------------------------------------------
00507051   1/1  ----------------------------------------------------------------------
00401511   1/1  ----------------------------------------------------------------------
00350041   1/1  ----------------------------------------------------------------------
00379461   1/1  ----------------------------------------------------------------------
00528341   1/1  ----------------------------------------------------------------------
00489381   1/1  ---ilvtlPdGsvkelpagvtpldvAysistglakkavaakvngelvdlstplenddeleilt-------
00484681   1/1  ---iyvtlPdGsvlelpagvtpldvAysistglakkavaakvngelvdlstplenddtveil--------
00379471   1/1  ----------------------------------------------------------------------
00425201   1/1  ----------------------------------------------------------------------
00446721   1/1  ----------------------------------------------------------------------
00469221   1/1  ----------------------------------------------------------------------
00425251   1/1  ----------------------------------------------------------------------
00460521   1/1  ----------------------------------------------------------------------
00464371   1/1  ----------------------------------------------------------------------
00483091   1/1  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           VVLWRTAAQVLANALHELYPNMKFGMGDVTEHGFYFDTDNSESQVAETDFEKISQKMSEIIKANLPIERV
00416341   1/1  ----------------------------------------------------------------------
00466381   1/1  ----------------------------------------------------------------------
00493781   1/1  ----------------------------------------------------------------------
00471651   1/1  ----------------------------------------------------------------------
00414221   1/1  ----------------------------------------------------------------------
00414261   1/1  ----------------------------------------------------------------------
00350051   1/1  ----------------------------------------------------------------------
00515191   1/1  ----------------------------------------------------------------------
00351941   1/1  ----------------------------------------------------------------------
00401521   1/1  ----------------------------------------------------------------------
00489341   1/1  ----------------------------------------------------------------------
00507061   1/1  ----------------------------------------------------------------------
00427371   1/1  lilrhsaahlLaaalkellgehvlqigslvedgfyyDfsl.dkplteeelekieklmnelikenlpierl
00353821   1/1  ----------------------------------------------------------------------
00499941   1/1  ----------------------------------------------------------------------
00416331   1/1  lmlrHsathlLaaalrkllgdaklqigslvedgfyyDfsldek.lteeelekieklvneiikenlpverl
00414201   1/1  ----------------------------------------------------------------------
00372141   1/1  ----------------------------------------------------------------------
00385211   1/1  ----------------------------------------------------------------------
00446511   1/1  lmrlHtatHlLaaalrkllgehlvlqigsligedglrfDfsl.pgklteeeleeieklvneiikenlpve
00414241   1/1  ----------------------------------------------------------------------
00416311   1/1  ----------------------------------------------------------------------
00351931   1/1  ----------------------------------------------------------------------
00427281   1/1  ----------------------------------------------------------------------
00507051   1/1  ----------------------------------------------------------------------
00401511   1/1  ----------------------------------------------------------------------
00350041   1/1  ----------------------------------------------------------------------
00379461   1/1  ----------------------------------------------------------------------
00528341   1/1  ----------------------------------------------------------------------
00489381   1/1  ----------------------------------------------------------------------
00484681   1/1  ----------------------------------------------------------------------
00379471   1/1  ----------------------------------------------------------------------
00425201   1/1  ----------------------------------------------------------------------
00446721   1/1  ----------------------------------------------------------------------
00469221   1/1  ----------------------------------------------------------------------
00425251   1/1  ----------------------------------------------------------------------
00460521   1/1  ----------------------------------------------------------------------
00464371   1/1  ----------------------------------------------------------------------
00483091   1/1  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           EFSEEEALNLVSGDEYQEELVRDVANKNNGRVVAYKQGDFIDITDGVVLSSTGEVKIFKLLSVAGAYWKG
00416341   1/1  ----------------------------------------------------------------------
00466381   1/1  ----------------------------------------------------------------------
00493781   1/1  ----------------------------------------------------------------------
00471651   1/1  ----------------------------------------------------------------------
00414221   1/1  ----------------------------------------------------------------------
00414261   1/1  ----------------------------------------------------------------------
00350051   1/1  ----------------------------------------------------------------------
00515191   1/1  ----------------------------------------------------------------------
00351941   1/1  ----------------------------------------------------------------------
00401521   1/1  ----------------------------------------------------------------------
00489341   1/1  ----------------------------------------------------------------------
00507061   1/1  ----------------------------------------------------------------------
00427371   1/1  evsleealelfalfgekykvelieelve.dgdevrvyrigdfvdlcggthvpntgeigafkllsvsgayw
00353821   1/1  ----------------------------------------------------------------------
00499941   1/1  ----------------------------------------------------------------------
00416331   1/1  evsleealelfalepyklaligekye..gdevrvvrigdfvdlcgGthvpntgeigafkilsesgaywrg
00414201   1/1  ----------------------------------------------------------------------
00372141   1/1  ----------------------------------------------------------------------
00385211   1/1  ----------------------------------------------------------------------
00446511   1/1  vlelsreealeifgalayklelipd....egeevrvvrigdfdvelcgGthvpnTgeigafkilsvsgay
00414241   1/1  ----------------------------------------------------------------------
00416311   1/1  ----------------------------------------------------------------------
00351931   1/1  ----------------------------------------------------------------------
00427281   1/1  ----------------------------------------------------------------------
00507051   1/1  ----------------------------------------------------------------------
00401511   1/1  ----------------------------------------------------------------------
00350041   1/1  ----------------------------------------------------------------------
00379461   1/1  ----------------------------------------------------------------------
00528341   1/1  ----------------------------------------------------------------------
00489381   1/1  ----------------------------------------------------------------------
00484681   1/1  ----------------------------------------------------------------------
00379471   1/1  ----------------------------------------------------------------------
00425201   1/1  ----------------------------------------------------------------------
00446721   1/1  ----------------------------------------------------------------------
00469221   1/1  ----------------------------------------------------------------------
00425251   1/1  ----------------------------------------------------------------------
00460521   1/1  ----------------------------------------------------------------------
00464371   1/1  ----------------------------------------------------------------------
00483091   1/1  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           ASSNPMLQRIYGTAFYKQKDLDAELQRQKEARERDHRVIGNELDLFFVDPKVGAGLPYWMPNGATIRRVI
00416341   1/1  ----------------------------------dhrelgkrlglidfereagsGlydllPlgarlrrkl
00466381   1/1  ---------------------------------kdhvelgkrlglfdiyggvk.Glydllplgarlrral
00493781   1/1  ----------vgtefdnvellkvglkrledaekrdhvelgkrlglidesaekvsgsGlyvllplgarllr
00471651   1/1  ----------------------kvlkpleedferdhvelgkrlglidfqg..vsGfydllplgarlrral
00414221   1/1  ------------------------------dakrdhrelglrlglidf.rlsgsGfyvllplgarlrral
00414261   1/1  ----------------------------eedaeldhvelllrlglldl.rlsvsGlydllPlgarlrrai
00350051   1/1  ------------------------------------------------iiqlpkgtrdllpaglrlrrki
00515191   1/1  ----------------------------------------------yllP...kGlrdllplglrlrski
00351941   1/1  ------------------------ltlkeealvalhkrrgfllrafeiygg.lsGlydylPlglrlknkl
00401521   1/1  ------------------------------------------------irqlpkGtrdylplglrlrrki
00489341   1/1  -------------------------------------------------irqlvsGlydllplglrlrrk
00507061   1/1  ----------------------------------------------gmi.rqlpsGlydwlplglrlrrk
00427371   1/1  lgdsknkglqRiygvagpdakelkeylkrleea-------------------------------------
00353821   1/1  --------------------ltlkleplvellkrrglllr.....ageiygggsGlydylPlglrllnkl
00499941   1/1  -------------------------------------------------------------lglrlrski
00416331   1/1  dsgnrrlqriyGtaaldklelkeylklleeakkr------------------------------------
00414201   1/1  ----------------------------------------------------------------------
00372141   1/1  ----------------------------------------------------------------------
00385211   1/1  ----------------------------------------------------------------------
00446511   1/1  gkg......lrRiyavagp---------------------------------------------------
00414241   1/1  ----------------------------------------------------------------------
00416311   1/1  ----------------------------------------------------------------------
00351931   1/1  ----------------------------------------------------------------------
00427281   1/1  ----------------------------------------------------------------------
00507051   1/1  ----------------------------------------------------------------------
00401511   1/1  ----------------------------------------------------------------------
00350041   1/1  ----------------------------------------------------------------------
00379461   1/1  ----------------------------------------------------------------------
00528341   1/1  ----------------------------------------------------------------------
00489381   1/1  ----------------------------------------------------------------------
00484681   1/1  ----------------------------------------------------------------------
00379471   1/1  ------------------------------------------------------------eklvellkrr
00425201   1/1  ------------------------------------------------kidvllgrrdllpgglhprskv
00446721   1/1  ----------------------------------------------------------------------
00469221   1/1  ------------------------------------------------------tlpllldlellpldkk
00425251   1/1  ------------------------------------RiyGydnipvtlp...............lhplqk
00460521   1/1  ------------------------------------------------------llPlpikklvslelrl
00464371   1/1  ------------------------------------------------------slelrlryryldlgrr
00483091   1/1  -------------------------------------------------lryldgrrdllpailrlrski


                         -         *         -         -         -         -         +:350
query           ERYIIDKEVAWGFQHVYTPVLANLNLYKQSGHWDHYREDMFPPMDMGDGEMLELRPMNCPSHIQVYNHHK
00416341   1/1  enfireelvklgyqevltPilvpaelleksghldkfgeemfkltkdregrdlyLrPtaepgitrlfadel
00466381   1/1  eniirevlvrygyqevltPilepaellkasghldgfgdemykf.drg.grdlaLrPtsevpiarlfanei
00493781   1/1  alenfireelvelgylevltPilvpaelleasghldkfgdelfkv....ededlyLrPTaeviltnlfrd
00471651   1/1  enfirevlleygylevltPileptellwkesghledfgdemykftdrggrdleeplyLrPtsevgitrlf
00414221   1/1  enfireell.lgyqevltPllvpaellwkesghlegfgdelfkvtklgkdregddlyLrPtsevpitrlf
00414261   1/1  eniireeldelgylevltPilvpaellekesghlegfgdelfrvtdrggnalgrelaLrptselpltrlf
00350051   1/1  eniirevferyGylevetPilepaelllgslggrldhygkemfrlkdr.ggrelaLrpdltppvarllaq
00515191   1/1  eniireffdkrGflevetPilepaelllrwegaghl.lvgkelftftdr.ggrelaLrpeltpq...lar
00351941   1/1  eniwreefvllregylevdtPillpaelwkaSghldkfgdelyklkdrggrfradhlleelleklleell
00401521   1/1  eeiirevfrryGyqevltPilepaelllrsagghwdiygkemyrfkdr.ggrelaLrpdltppiarlfa.
00489341   1/1  ieniireffeerGflevetPilepaelleesaghlldkfakelftvtdrg.grelaLrpelTaevarlll
00507061   1/1  iediireffderGflevetPilepaellkesggedifge.mftftdr.ggrelaLrPettpqlarklllr
00427371   1/1  ----------------------------------------------------------------------
00353821   1/1  eniwreelvllregylevdtPillpaelwkaSghldifgdelyklkdrkglseprefnlmfetllgPthe
00499941   1/1  ed.irevfdrygflevetPilepaellgas...........dfldrs.grelaLrpdltpp....larll
00416331   1/1  ----------------------------------------------------------------------
00414201   1/1  ----------------------------------------------------------------------
00372141   1/1  ----------------------------------------------------------------------
00385211   1/1  ----------------------------------------------------------------------
00446511   1/1  ----------------------------------------------------------------------
00414241   1/1  ----------------------------------------------------------------------
00416311   1/1  ----------------------------------------------------------------------
00351931   1/1  ----------------------------------------------------------------------
00427281   1/1  ----------------------------------------------------------------------
00507051   1/1  ----------------------------------------------------------------------
00401511   1/1  ----------------------------------------------------------------------
00350041   1/1  ----------------------------------------------------------------------
00379461   1/1  ----------------------------------------------------------------------
00528341   1/1  ----------------------------------------------------------------------
00489381   1/1  ----------------------------------------------------------------------
00484681   1/1  ----------------------------------------------------------------------
00379471   1/1  gfvfpseesleiseiygGlswdyGPlgveLknnlkelWwksfvllredvvgldslhlevlkasghv....
00425201   1/1  ieaireiflslgflevetPilesaesnfdallfpvdhpardlqdtfylggavakelytfkdyfgrd.llL
00446721   1/1  ----------------------------------------------------------------------
00469221   1/1  lvslelrlryryldgrrdllpailrvrskieraireffdergflevetPi.....Ltkssgeg..agkel
00425251   1/1  llrrlreilaglGftEvitfsllslelahparlmq....dtvyllnPlseersvLRtsllpgllralayn
00460521   1/1  ryryldgrrdllpailrvrskiesaireffdergflevetPilepaell.......gagkelftfkdrg.
00464371   1/1  dllpailrlrskiisaireffeergflevetPi.....Ltkssgeg..vakelftfsdrf.grdlyLrps
00483091   1/1  isaireffeeygflevetPilepseleg........akelf.ftdrg.grdlyLrp--------------


                         -         -         -         -         *         -         -:420
query           RSYRELPLRIAELGMMHRYEKSGALTGLSRVREMTLNDGHDFIEPDHIEDEIKTLIKLMTEVYNDFDITD
00416341   1/1  lsyrdlPlrlyqigtvfRnEasgrgrGLlRvreFtqvdahifgdpeqaeeeleelldlyleilkrlglpy
00466381   1/1  lsyrdlPlrlyqigpvFRnEarprlrGllRvreFtqveaeifgtpeqaldelaellalaleilerlglpy
00493781   1/1  eilsyrdlPlrlaqigtcfRnEassaGrplrGLlRvreFtqveahiFvdpdleqaleeleelldlyeeil
00471651   1/1  anlilsyrdlPlrlyqigpvfRnEaspr..gLlRvreFtqveaheifgtpeqaadeleelldlaleiler
00414221   1/1  adeilsyrdlPlrlyqigtvfRnEarp.trgllRvreFtsqveahifhvtpedadeeleelldlyeeilk
00414261   1/1  rdeilsyrdlPlrlyqigpvFRnEgrptr.gLlRvreFtqmkvehffhadpedaeeeleelldlyeeile
00350051   1/1  nllsykelplrlyyigpvFRdErp....glgrlreftqvdaeifgadsedadae..liallleilkrlgl
00515191   1/1  lllrsgrdlPlrlyqigpvFRdErp....glgRlreFtqldaeifgadsedadae...vedllleilkel
00351941   1/1  ldlelkkeleslllellglsleelkelieeydikcPlcgekgdlteprpFnlmfdtllgPtaeevltlyl
00401521   1/1  ellsyrdlplrlyyigpvFRdErp....glgrlreftqldaeifgadseda..daevlallleilkrlgl
00489341   1/1  knllvsgrdlPlrlyqigpvFRnErprag....RvreFtqleaeifgadsedadae..vldllleilkel
00507061   1/1  ..sgrdlPlrlyqigpvFRnErpg..ag..RlrEFtqldaeifgadeedadae..vldllleilkrlglp
00427371   1/1  ----------------------------------------------------------------------
00353821   1/1  evltlllrpetaqgifvnfknllllsykklPlrlaqigkkFRnEirP.rnGLlRvreFtqkeaesFvlpe
00499941   1/1  lmsyrdlplrlyqigpvfRdErpg......rvref.qldae.ifgeddlaadae.viallleilkelglk
00416331   1/1  ----------------------------------------------------------------------
00414201   1/1  ----------------------------------------------------------------------
00372141   1/1  ----------------------------------------------------------------------
00385211   1/1  ----------------------------------------------------------------------
00446511   1/1  ----------------------------------------------------------------------
00414241   1/1  ----------------------------------------------------------------------
00416311   1/1  ----------------------------------------------------------------------
00351931   1/1  ----------------------------------------------------------------------
00427281   1/1  ----------------------------------------------------------------------
00507051   1/1  ----------------------------------------------------------------------
00401511   1/1  ----------------------------------------------------------------------
00350041   1/1  ----------------------------------------------------------------------
00379461   1/1  ----------------------------------------------------------------------
00528341   1/1  ----------------------------------------------------------------------
00489381   1/1  ----------------------------------------------------------------------
00484681   1/1  ----------------------------------------------------------------------
00379471   1/1  radhlvcpetlgellteprlfnlmfktligplldssgylrpetaqgifvnfknllelarkklPfgiaqiG
00425201   1/1  rthttlvlarllasllk.....PlrvfeigpvFRaErsda....thlpeFhqlegevagadlslaeligl
00446721   1/1  ----------------------------------------------------------------------
00469221   1/1  frfkdrg.grelaLrpspelylkrllaagld.......rvyqigpvFRdErprtg....RhrEFtqldae
00425251   1/1  lnrglklPirlfeigrvfrndeplvlaghlr..gfhqleglv.vdkdvdfadlkglleallealgl....
00460521   1/1  grdlaLrpspelylarllaggld.......rvyqigpvFRdErprtg....rlrEFtqldaemagadye.
00464371   1/1  pelylkrllaggld.......rvyqigpvFRdErp....garrlrEFtqldaemaga..dyedlmaelea
00483091   1/1  ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           YRFRLSYRDPKNTEKYFDDDEMWEKSQSKLKAAMDDMGLEYFEAEGEAAFYGPKIDVQTKTALGGEETLS
00416341   1/1  rvlrlstgdiggsakytgdievwlpaenglreilscsnldyfqlrglaafygpkldvllkdalgrtlqgs
00466381   1/1  rvvrlntgd....lgfagdlefwlpaeaglreilsalncddfqalglnalygldidfelkdelvrtlngt
00493781   1/1  erlglp.yrvvlltsg....elgagasktyd............................leawfpldgal
00471651   1/1  lglepyrvvlntrgdlg....................................ayagpkidfevllplgr
00414221   1/1  rlglpyrvvrlstgd...................................lgegasygydieawlpd..g
00414261   1/1  elglpyrvvrldsge...................................lgggasytydieallpd..g
00350051   1/1  kdvrlelnslgi..lealleylglllsaefallealdeddivrleavplgildekaegllellellgags
00515191   1/1  glkyvvvrlsdrgalg..glle...vlgdarealielldklglalliellelglfvgplliallkdvldr
00351941   1/1  rpetaqgifvnfknllllsykklPlrlaqigkkFRnEirP.rnGLlRvReFtqkeaesFvlpedaletye
00401521   1/1  eddvtlklnhrglleavlaylgllgdllsrlfdvldklgedrleknllrildfkrggyaevlekaealld
00489341   1/1  glpyvvvelgtgdile.....eflalydvledalrallealdlani..eglgafylkkldikvedalgll
00507061   1/1  dfvrlrlntrp....ilglgsdefdleagealiealdklglaanievld.alygpklldelldaldelvg
00427371   1/1  ----------------------------------------------------------------------
00353821   1/1  daletyeymlaaylrilkklglpyrvlrl...................................revlad
00499941   1/1  dltlklnhrgll..dallg..gldkpdlrallealdkldlldldsvlgllanplplldlkggdalgldrl
00416331   1/1  ----------------------------------------------------------------------
00414201   1/1  ----------------------------------------------------------------------
00372141   1/1  ----------------------------------------------------------------------
00385211   1/1  ----------------------------------------------------------------------
00446511   1/1  ----------------------------------------------------------------------
00414241   1/1  ----------------------------------------------------------------------
00416311   1/1  ----------------------------------------------------------------------
00351931   1/1  ----------------------------------------------------------------------
00427281   1/1  ----------------------------------------------------------------------
00507051   1/1  ----------------------------------------------------------------------
00401511   1/1  ----------------------------------------------------------------------
00350041   1/1  ----------------------------------------------------------------------
00379461   1/1  ----------------------------------------------------------------------
00528341   1/1  ----------------------------------------------------------------------
00489381   1/1  ----------------------------------------------------------------------
00484681   1/1  ----------------------------------------------------------------------
00379471   1/1  kcFRseagneisprgl------------------------------------------------------
00425201   1/1  leellke---------------------------------------------------------------
00446721   1/1  ----------------------------------------------------------------------
00469221   1/1  mag..adye-------------------------------------------------------------
00425251   1/1  evrfrpsef-------------------------------------------------------------
00460521   1/1  .elldllee-------------------------------------------------------------
00464371   1/1  llrdl-----------------------------------------------------------------
00483091   1/1  ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:560
query           TIQLDFLLPERFDLKYIGADGEEHRPVMVHRGIVSTMERFTAYLTEMYKGAFPTWLAPHQVDIIPVKNDL
00416341   1/1  tfqldrklperlelnyqdedgkikrPvvlhrgiyGsveRliaali-------------------------
00466381   1/1  tlaldrlllailelnyqgedgslviPvvlhpalvggleryigilfEayagl-------------------
00493781   1/1  ievgscsnl.gdfq.arrldiryldedgkkelphtlngsglG.veRllaallenyqdedglvllPpa---
00471651   1/1  yielgtisnlgdyqarrldiryldedgk...pvlvhtnglglgeRllaall-------------------
00414221   1/1  ryievgtisqlgdylaerlgiryldedgk...pvilhhtlnGsglRllaal-------------------
00414261   1/1  rgievgtisqlgdfqaerfdiryldedgk...pvhvlngsygigeRllaal-------------------
00350051   1/1  lleklleealgrleqlleylkalgvpvrldlslvrgldyytgvvFellargig-----------------
00515191   1/1  pllvleqaplilldfllperfellvaglellnvgypvlidpslvrgleyytgivfeayag----------
00351941   1/1  ymlalylrilkklglppenlrfrlv..ladelahyasdswdf..........evlfpfgldel-------
00401521   1/1  pllaealeeleallealeal--------------------------------------------------
00489341   1/1  atlntildaldfellerlel.yvdgleaagvpvlldpalvrgldyytgivfelyakalealgl-------
00507061   1/1  lptflldfplplsplaevlerfelvlaglelaggspelidpslqrgleyytgi-----------------
00427371   1/1  ----------------------------------------------------------------------
00353821   1/1  egahygsksidfevlfpagedelvgcsnrtdydlrehalgsgedlvtilllaelkevltleyv-------
00499941   1/1  aplltdqldfealerlealleylgalgikl.pvvidlalvrgldyytgivfeiyaggl------------
00416331   1/1  ----------------------------------------------------------------------
00414201   1/1  -----------------------------------------------yglvlPpwlAPvqvvviplglkd
00372141   1/1  ---------------------------------------------------fPpwlaPvqvvvvpi.gee
00385211   1/1  -----------------------------------------------yglvlPpwlAPvqvvvipislkd
00446511   1/1  ----------------------------------------------------------------------
00414241   1/1  -----------------------------------------------yglvlPpwlAPvqvvvipislkd
00416311   1/1  ---------------------------------------------ddyglvlPpwlaPvqvvvvplgdee
00351931   1/1  ------------------------------------------------------wlAPvqvvviplllkd
00427281   1/1  ------------------------------------------------------wlaPvqvvvipl.gee
00507051   1/1  -------------------------------------------------------laPvqvvvvpl.gee
00401511   1/1  -------------------------------------------------------lapvdvyvvpl.gee
00350041   1/1  -------------------------------------------------------lapvdvyvvpl.gee
00379461   1/1  ----------------------------------------------rvvlklppalaPvkvavlplglkk
00528341   1/1  ----------------------------------------------rtvlilppalAPikvailplslkk
00489381   1/1  ----------------------------------------------------------------------
00484681   1/1  ----------------------------------------------------------------------
00379471   1/1  ----------------------------------------------------------------------
00425201   1/1  ----------------------------------------------------------------------
00446721   1/1  ---------------------------------------------------------lgnvstePvqcvv
00469221   1/1  ----------------------------------------------------------------------
00425251   1/1  ----------------------------------------------------------------------
00460521   1/1  ----------------------------------------------------------------------
00464371   1/1  ----------------------------------------------------------------------
00483091   1/1  ----------------------------------------------------------------------


                         -         -         -         *         -         -         -:630
query           HMDYVNDLSSKLRAHGIRVTVDDRNEKMGYKIRQAQVNKIPYTLVIGDEEVSNGTVTVRKYGEEKTNTMT
00416341   1/1  ----------------------------------------------------------------------
00466381   1/1  ----------------------------------------------------------------------
00493781   1/1  ----------------------------------------------------------------------
00471651   1/1  ----------------------------------------------------------------------
00414221   1/1  ----------------------------------------------------------------------
00414261   1/1  ----------------------------------------------------------------------
00350051   1/1  ----------------------------------------------------------------------
00515191   1/1  ----------------------------------------------------------------------
00351941   1/1  ----------------------------------------------------------------------
00401521   1/1  ----------------------------------------------------------------------
00489341   1/1  ----------------------------------------------------------------------
00507061   1/1  ----------------------------------------------------------------------
00427371   1/1  ----------------------------------------------------------------------
00353821   1/1  ----------------------------------------------------------------------
00499941   1/1  ----------------------------------------------------------------------
00416331   1/1  ----------------------------------------------------------------------
00414201   1/1  seeelleyaeelakeLraagirvllddrneslgkkfrdadligipyrlvvGdkeledgtvtvrrrdtgeq
00372141   1/1  lleyalelakeLraagirvelddrneslgkkirdadligipyvlvvGdkelengtvtvrrrdtgeqvtvs
00385211   1/1  seeelleyaeelakeLraagirvllddrdelsigkkirdadligvPyrlvvGdkeledgtvtvrrrdt.e
00446511   1/1  ----------------------------------------------------------------------
00414241   1/1  sleelleyaeelakeLra.girvllddrnesigkkirdaeligiPlrivvGdkeledgtvtvrrrdtgeq
00416311   1/1  lleyalelaeeLraagirvelddrgeslgkkirdadligipyvlvvGekelengtvtvrdrdtgeqvtvs
00351931   1/1  ee.lleyaeklaaeLraagirvllddrdesigkkfrradligvpfrivvGekeleegedaaeeedgtvtv
00427281   1/1  aleyalklaeelrdagirveldlrgeklgkkikdadligipyvlvvGekelengtvtvknrdtgeqetvs
00507051   1/1  aleyalelaeeLraagirveldlrgeklgkklkeadligapyalviGekelengtvtvkdrdtgeqetvs
00401511   1/1  aleyalklaeeLraalpgirvelddsgrslgkqlkradkigapfaviiGedeledgtvtlkdldtgeqvt
00350041   1/1  aleyalklaekLrd.girveldlsgeklkkqlkradklgapfaviiGedelesgtvtlkdldtgeqvtvs
00379461   1/1  eellelalelyneLreagisvlydykedsdgsigkryaradeigipfavtigedelengtvtvrdrdtge
00528341   1/1  eellelaeelyneLrkagisvllddleddsgsigkryaradeigipfritigedtlengtvtlrdrdtme
00489381   1/1  ----------------------------------------------------------------------
00484681   1/1  ----------------------------------------------------------------------
00379471   1/1  ----------------------------------------------------------------------
00425201   1/1  ----------------------------------------------------------------------
00446721   1/1  ipvnke.qleYaesvgrrLrelGlrvdllflneevslgkaledvksqgvpyaivvgeeeqilssctvnvl
00469221   1/1  ----------------------------------------------------------------------
00425251   1/1  ----------------------------------------------------------------------
00460521   1/1  ----------------------------------------------------------------------
00464371   1/1  ----------------------------------------------------------------------
00483091   1/1  ----------------------------------------------------------------------


                         -         +         -         -         -         -         *:700
query           KAEFKNLLFEDIENYSREK---------------------------------------------------
00416341   1/1  ----------------------------------------------------------------------
00466381   1/1  ----------------------------------------------------------------------
00493781   1/1  ----------------------------------------------------------------------
00471651   1/1  ----------------------------------------------------------------------
00414221   1/1  ----------------------------------------------------------------------
00414261   1/1  ----------------------------------------------------------------------
00350051   1/1  ----------------------------------------------------------------------
00515191   1/1  ----------------------------------------------------------------------
00351941   1/1  ----------------------------------------------------------------------
00401521   1/1  ----------------------------------------------------------------------
00489341   1/1  ----------------------------------------------------------------------
00507061   1/1  ----------------------------------------------------------------------
00427371   1/1  ----------------------------------------------------------------------
00353821   1/1  ----------------------------------------------------------------------
00499941   1/1  ----------------------------------------------------------------------
00416331   1/1  ----------------------------------------------------------------------
00414201   1/1  vtvsldelvellke--------------------------------------------------------
00372141   1/1  ldelvellkelleeisln----------------------------------------------------
00385211   1/1  qetvsldelvellkelle----------------------------------------------------
00446511   1/1  ----------------------------------------------------------------------
00414241   1/1  vrvsldelvellkel-------------------------------------------------------
00416311   1/1  ldelvellkelleeiltl----------------------------------------------------
00351931   1/1  rdrdtgeqervsld--------------------------------------------------------
00427281   1/1  ldelvellke------------------------------------------------------------
00507051   1/1  ldelvelllelle---------------------------------------------------------
00401511   1/1  vpldelvellke----------------------------------------------------------
00350041   1/1  ldelvellkells---------------------------------------------------------
00379461   1/1  qervkidelvdyl---------------------------------------------------------
00528341   1/1  qervsidelvdyllelld----------------------------------------------------
00489381   1/1  ----------------------------------------------------------------------
00484681   1/1  ----------------------------------------------------------------------
00379471   1/1  ----------------------------------------------------------------------
00425201   1/1  ----------------------------------------------------------------------
00446721   1/1  hgapkehrnmpledaltlv---------------------------------------------------
00469221   1/1  ----------------------------------------------------------------------
00425251   1/1  ----------------------------------------------------------------------
00460521   1/1  ----------------------------------------------------------------------
00464371   1/1  ----------------------------------------------------------------------
00483091   1/1  ----------------------------------------------------------------------