[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for lsal0:ABD99339.1


[Show Plain Result]

## Summary of Sequence Search
   1::185
  65::129  1.2e-25 53.8% 0047483 00474831 1/1   ic acid-binding proteins                
   1::63   5.9e-23 66.7% 0049873 00498731 1/1   lation proteins SH3-like domain         
  64::127  2.5e-22 56.2% 0045976 00459761 1/1   ic acid-binding proteins                
  64::127  1.3e-21 52.4% 0044302 00443021 1/1   ic acid-binding proteins                
  65::126  4.1e-21 55.9% 0052498 00524981 1/1   ic acid-binding proteins                
   1::63   2.5e-20 60.3% 0045975 00459751 1/1   lation proteins SH3-like domain         
   1::64   2.2e-19 60.9% 0047482 00474821 1/1   lation proteins SH3-like domain         
 128::185  2.4e-19 58.6% 0044303 00443031 1/1   ic acid-binding proteins                
   1::64   2.9e-19 56.2% 0052497 00524971 1/1   lation proteins SH3-like domain         
   1::64   4.8e-17 54.7% 0050864 00508641 1/1   lation proteins SH3-like domain         
   1::185


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MISVNEFKNGLTIEVDGELWRVVEFQHVKPGKGSAFVRSKLKNLRTGAVQEKTFRAGEKVNQAQIDRKKM
00474831   1/1  ----------------------------------------------------------------iekkea
00498731   1/1  misaselrkGlvieldgelyvvleaehvkpGkggafvrvklknlltgavleltfksgekveva-------
00459761   1/1  ---------------------------------------------------------------iiekktm
00443021   1/1  ---------------------------------------------------------------lleerem
00524981   1/1  ----------------------------------------------------------------iekkem
00459751   1/1  klalstlmisagdlkkGlyivldgepckvveistvkpGkhGsafvrvklknlltgkklektfp-------
00474821   1/1  lstllisvndlkkGlvilldgepckvveistvkpGkhGsafvrvklknlltgkklektfpsgdk------
00443031   1/1  ----------------------------------------------------------------------
00524971   1/1  eagasetllisvgdlkkGlyilldgePckvveistvkpGkhGsafvriklrdlftgkklektfp------
00508641   1/1  dtvmisvgdlkkGlyllldgePckvveistvkpGkhGsakvrvklrdlftgkklektfpsgdkv------


                         -         -         *         -         -         -         -:140
query           QYLYADGDNYVFMDTNTYEQLELPGSQIEEELKYMKENMVVSIIMFGTETLGVELPNTVDLEVKETEPGI
00474831   1/1  qylyidgdllvfmDletYeqielplelllegdalkfLkegmevevllyegevlgvelPt-----------
00498731   1/1  ----------------------------------------------------------------------
00459761   1/1  qylyidgdllvfmDletYeqielplelleeellkflkegmevevllyegkvlgvelP-------------
00443021   1/1  qylyldgdlyvfmdtetyeqielpkellgda.kyLkegmevlvllyngeplsvelPt-------------
00524981   1/1  qylyidgdllvfMDletYeqielple...dllkflkegmevevllyegevlivelP--------------
00459751   1/1  ----------------------------------------------------------------------
00474821   1/1  ----------------------------------------------------------------------
00443031   1/1  ---------------------------------------------------------tvelevvetepav
00524971   1/1  ----------------------------------------------------------------------
00508641   1/1  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           KGDTSSGGSKPATMETGLVVQVPFFVSEGDVLTINTSDGTYISRA-------------------------
00474831   1/1  ----------------------------------------------------------------------
00498731   1/1  ----------------------------------------------------------------------
00459761   1/1  ----------------------------------------------------------------------
00443021   1/1  ----------------------------------------------------------------------
00524981   1/1  ----------------------------------------------------------------------
00459751   1/1  ----------------------------------------------------------------------
00474821   1/1  ----------------------------------------------------------------------
00443031   1/1  kGdtasgslkpatletGlevqvPlfieegekikvdtrtgeyverv-------------------------
00524971   1/1  ----------------------------------------------------------------------
00508641   1/1  ----------------------------------------------------------------------