[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for lsal0:ABD99372.1


[Show Plain Result]

## Summary of Sequence Search
   1::260
  19::249  3.4e-85 51.8% 0039684 00396841 1/1   aprenyl diphosphate synthase            
  17::248  4.1e-85 52.0% 0037424 00374241 1/1   aprenyl diphosphate synthase            
   1::260


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MLDFFNKKENMDEKRNKLKRELIPNHIAIIMDGNGRWAKKRHLPRIAGHKQGMETVKNITKVASNLGVKV
00396841   1/1  ------------------klgklPkhvAiimDGngRwAkkrglerllghkagveallelvewclelgikv
00374241   1/1  ----------------vlklgklPkhvAiimDGNgRwAkkrglerlegheagvealleivewclelgiky


                         -         -         *         -         -         -         -:140
query           LTLYAFSTENWKRPDKEVDFLMDLPVKFFNTFVPELIENNVRVNVMGYIDMLPKKTQKAVYDAIEQTSNC
00396841   1/1  ltlYafstenwkrpkeevsflmdllldaleelldlllklgvrlrvigdlsllpeellellekaeeltknn
00374241   1/1  ltlYafstenwkrpkeevsflmklllelleellelllkngvrlrvigdlsllpedllelleeaeeltann


                         +         -         -         -         -         *         -:210
query           TGMVLNFALNYGGRAELVSAIQSIASKVSENKLEIEKITEKVVDANLMTGKLAPYNDPDLLIRTSGEERI
00396841   1/1  tgltlnlavnyggrdeivdavkklaelvaagklspedideelldshLyts...vlpdpDLlirtsgelrl
00374241   1/1  tgltlnlalnyggrdeivdavkklaeevaegklspediteelldslLyts...glpdpDLlirtggelrl


                         -         -         -         +         -         -         -:280
query           SNFLLWQLAYSEFVFTDTLWPDYSEEDLLANIYTFQTRDRRFGRLKEEKK--------------------
00396841   1/1  snFllWqiayselyftdvlWpdfdlldllralldyqkre-------------------------------
00374241   1/1  snFllWqiaytelyftdvlWpdfdlldllralldyqrr--------------------------------