[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for lsal0:ABD99378.1


[Show Plain Result]

## Summary of Sequence Search
   1::375
   1::126    1e-41 57.9% 0038593 00385931 1/1   cription factor NusA, N-terminal domain 
   1::122  6.2e-34 60.0% 0039834 00398341 1/1   cription factor NusA, N-terminal domain 
 199::276  1.4e-30 60.3% 0047188 00471881 1/1   ryotic type KH domain (KH-domain type I 
 199::277  2.6e-30 60.8% 0047716 00477161 1/1   ryotic type KH domain (KH-domain type I 
 278::344  6.6e-20 53.7% 0039833 00398331 1/1   ryotic type KH domain (KH-domain type I 
 131::198  6.4e-19 45.6% 0047715 00477151 1/1   ic acid-binding proteins                
 277::344  1.5e-18 52.9% 0038592 00385921 1/1   ryotic type KH domain (KH-domain type I 
 127::198    4e-18 37.5% 0038590 00385901 1/1   ic acid-binding proteins                
 114::221  2.9e-10 21.7% 0050575 00505751 1/1   ic acid-binding proteins                
 131::206  2.6e-07 18.4% 0052107 00521071 1/1   ic acid-binding proteins                
 127::198  5.4e-05 20.6% 0040675 00406751 1/1   ic acid-binding proteins                
 132::219  6.3e-05 22.7% 0047019 00470191 1/1   ic acid-binding proteins                
 132::203  8.9e-05 19.4% 0051177 00511771 1/1   ic acid-binding proteins                
   1::375


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MSKELLNALNALEVEKGVKKEIVIEALEAALVSAYKRNYGQAQNVEVEFDKIAGNIHVYAVKEVVNEVYD
00385931   1/1  mnlellealeaiakekgidkevviealeeALlkaykkkygsdanvrveidretgevkvfrlkevvedved
00398341   1/1  lsllmlkellealealakekgidkevviealeeALllAykkkygldlnvrveidrktGevevla......
00471881   1/1  ----------------------------------------------------------------------
00477161   1/1  ----------------------------------------------------------------------
00398331   1/1  ----------------------------------------------------------------------
00477151   1/1  ----------------------------------------------------------------------
00385921   1/1  ----------------------------------------------------------------------
00385901   1/1  ----------------------------------------------------------------------
00505751   1/1  ----------------------------------------------------------------------
00521071   1/1  ----------------------------------------------------------------------
00406751   1/1  ----------------------------------------------------------------------
00470191   1/1  ----------------------------------------------------------------------
00511771   1/1  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           SQLEISLKSALEINRAYEIGDTIREEVTPKDFGRIAAQTAKQVIMQRVRKEEREVIYNEYVQYEQEIVTG
00385931   1/1  plleisleeAkeidpdvevGdvvelevtpedfgriaaqtakqvilqklreaereli--------------
00398341   1/1  ................idpdaelgdvvelevtpedfgriaaqtakqvilqkl------------------
00471881   1/1  ----------------------------------------------------------------------
00477161   1/1  ----------------------------------------------------------------------
00398331   1/1  ----------------------------------------------------------------------
00477151   1/1  ------------------------------------------------------------kdregeivtG
00385921   1/1  ----------------------------------------------------------------------
00385901   1/1  --------------------------------------------------------yeefklkegeivtG
00505751   1/1  -------------------------------------------islslkelledsllsledlkvGdvvtG
00521071   1/1  ------------------------------------------------------------kpfkgevveG
00406751   1/1  --------------------------------------------------------ellellevgdvveG
00470191   1/1  -------------------------------------------------------------lkvGevveG
00511771   1/1  -------------------------------------------------------------PfkgevveG


                         +         -         -         -         -         *         -:210
query           EVERRDNKFVYVNLGRIEAVLSRQDQIPGEEYKSHDKIKVYIYKVENTSKGPQVFVSRSHPDLLRRLFEQ
00385931   1/1  ----------------------------------------------------------------------
00398341   1/1  ----------------------------------------------------------------------
00471881   1/1  ----------------------------------------------------------tspellkkllel
00477161   1/1  ----------------------------------------------------------tspellkkllel
00398331   1/1  ----------------------------------------------------------------------
00477151   1/1  tVkrvaraeerggvfvdlggeeegvegllpvselipgevlkvgdrvkvyvlevdkesk------------
00385921   1/1  ----------------------------------------------------------------------
00385901   1/1  tVvrvtkggvfVdlggvegllplselspgevlkvgdrvkvkvlevdkerkgivlslkr------------
00505751   1/1  tVvsvtdfgvfVdlglggveGlvpiselsddlrvedpeevlkvGdevkvkvlsvdpekg..risLSlkka
00521071   1/1  vVtsvtkfgvfVdlggvegfvpiselsddrvydfdekllllvgedlelvlkvgdevrvkvlevdke----
00406751   1/1  kVv.itdfgvfVdlgelggveglvpiselsllkrvedpsell.vGdevkvkvlevdke------------
00470191   1/1  tVvsvtdfgafVdlggveGlvhiselsddrvlfdeerlalvgedpsevlkvGdevevkvlevdlergeld
00511771   1/1  tVvsvtkfgvfvdlggvegfvplselsddrvfdedenllvwedlelvlkvgdevrvkvlgvdl-------


                         -         -         -         +         -         -         -:280
query           EIPEIFDGTVEIVSISREAGDRAKVAVRSNEDGVDPVGTCVGPRGERVQAIVNELKGENMDIVEWREDPA
00385931   1/1  ----------------------------------------------------------------------
00398341   1/1  ----------------------------------------------------------------------
00471881   1/1  evPeiadglveiksiaRepGlrakvavlsndenvdpvgacvGlkgsrvkavveelngekidivlys----
00477161   1/1  evPeiadglveiksiaRepGlrakvavlsndenvdpvgacvGlkgsrvkavveelngekidivlyse---
00398331   1/1  -------------------------------------------------------------------dla
00477151   1/1  ----------------------------------------------------------------------
00385921   1/1  ------------------------------------------------------------------edll
00385901   1/1  ----------------------------------------------------------------------
00505751   1/1  lleeaweelee-----------------------------------------------------------
00521071   1/1  ----------------------------------------------------------------------
00406751   1/1  ----------------------------------------------------------------------
00470191   1/1  llrivLslk-------------------------------------------------------------
00511771   1/1  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           EYIANALNPAKVLDVRFDDENEHACTVVVPDDQLSLAIGKRGQNARLAARLTGYKIDIKSESDAADLNNV
00385931   1/1  ----------------------------------------------------------------------
00398341   1/1  ----------------------------------------------------------------------
00471881   1/1  ----------------------------------------------------------------------
00477161   1/1  ----------------------------------------------------------------------
00398331   1/1  efianalapaevldvlvldeddkvarvlvpddkvglvIGkgGeniklireltgakidildlsel------
00477151   1/1  ----------------------------------------------------------------------
00385921   1/1  elianalapakvlsvlildeedktlrvlvppdklglvIGkgGeniklireltgakidildlsel------
00385901   1/1  ----------------------------------------------------------------------
00505751   1/1  ----------------------------------------------------------------------
00521071   1/1  ----------------------------------------------------------------------
00406751   1/1  ----------------------------------------------------------------------
00470191   1/1  ----------------------------------------------------------------------
00511771   1/1  ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           EADNNDIDDEDQLMSDSSSNIIEEE---------------------------------------------
00385931   1/1  ----------------------------------------------------------------------
00398341   1/1  ----------------------------------------------------------------------
00471881   1/1  ----------------------------------------------------------------------
00477161   1/1  ----------------------------------------------------------------------
00398331   1/1  ----------------------------------------------------------------------
00477151   1/1  ----------------------------------------------------------------------
00385921   1/1  ----------------------------------------------------------------------
00385901   1/1  ----------------------------------------------------------------------
00505751   1/1  ----------------------------------------------------------------------
00521071   1/1  ----------------------------------------------------------------------
00406751   1/1  ----------------------------------------------------------------------
00470191   1/1  ----------------------------------------------------------------------
00511771   1/1  ----------------------------------------------------------------------