[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for lsal0:ABD99438.1


[Show Plain Result]

## Summary of Sequence Search
   1::112
   4::109  1.5e-30 42.5% 0049340 00493401 1/1   3 and sigma4 domains of RNA polymerase  
   2::107  1.5e-28 43.4% 0051096 00510961 1/1   3 and sigma4 domains of RNA polymerase  
  19::78   6.3e-07 35.0% 0049651 00496511 1/1   3 and sigma4 domains of RNA polymerase  
  20::69   0.00067 30.0% 0049224 00492241 1/1   3 and sigma4 domains of RNA polymerase  
   1::112


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MAIEKTNRINALFDFYEPLLTPKQMTYIGLYYRDDYSLGEIAENYEVSRQAVYDNIRRTEKILEEYESKL
00493401   1/1  ---ektlelnlLldfylelLpekqrevlelyyledlslkEIAeilgisrqaVkdllkralkkLreylekl
00510961   1/1  -elekllelnllldfylelLtekqrevlllyyledlslkEIAeilgisrqaVkdrlkralkkLreylekl
00496511   1/1  ------------------lLtererevlrlryglddgedltleeiaellgisrervrqiekralkkLrkl
00492241   1/1  -------------------LpererevlllryleglslkeiAeilgisvgtvksrlarAlkkLrellee-


                         -         -         *         -         -         -         -:140
query           HLYRNFQLQSEELDNLLKYVEENYAYDKELLTRINRLESLEE----------------------------
00493401   1/1  gllekflkrkelleellelldelesldellellelleel-------------------------------
00510961   1/1  hlvekflkrkelleellelleelllldellellllle---------------------------------
00496511   1/1  lrklllll--------------------------------------------------------------
00492241   1/1  ----------------------------------------------------------------------