[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for lsal0:ABD99450.1


[Show Plain Result]

## Summary of Sequence Search
   1::565
   4::424  4.5e-43 26.4% 0051194 00511941 1/1   lo-hydrolase/oxidoreductase             
   4::266  2.1e-41 28.4% 0051022 00510221 1/1   lo-hydrolase/oxidoreductase             
   4::421  1.3e-39 27.6% 0051591 00515911 1/1   lo-hydrolase/oxidoreductase             
   1::209  1.5e-38 28.4% 0036363 00363631 1/1   lo-hydrolase/oxidoreductase             
   1::249  2.3e-37 26.7% 0046465 00464651 1/1   lo-hydrolase/oxidoreductase             
   3::249  2.3e-37 23.3% 0051275 00512751 1/1   lo-hydrolase/oxidoreductase             
   1::421  2.4e-37 27.7% 0051980 00519801 1/1   lo-hydrolase/oxidoreductase             
   4::189  2.1e-33 28.7% 0048073 00480731 1/1   lo-hydrolase/oxidoreductase             
   4::423  2.2e-33 27.9% 0050726 00507261 1/1   lo-hydrolase/oxidoreductase             
   4::421  3.9e-33 25.3% 0052141 00521411 1/1   lo-hydrolase/oxidoreductase             
   4::189  7.5e-33 31.5% 0045185 00451851 1/1   lo-hydrolase/oxidoreductase             
   1::255  5.9e-31 25.6% 0050252 00502521 1/1   lo-hydrolase/oxidoreductase             
   5::189  3.8e-30 30.3% 0045733 00457331 1/1   lo-hydrolase/oxidoreductase             
   4::189  1.6e-29 30.2% 0047843 00478431 1/1   lo-hydrolase/oxidoreductase             
   4::249    2e-29 24.2% 0042783 00427831 1/1   lo-hydrolase/oxidoreductase             
   4::422  2.7e-29 24.1% 0051102 00511021 1/1   lo-hydrolase/oxidoreductase             
  24::214  3.9e-29 26.3% 0051863 00518631 1/1   lo-hydrolase/oxidoreductase             
   1::196  6.3e-28 27.4% 0048716 00487161 1/1   lo-hydrolase/oxidoreductase             
   1::230  9.2e-28 27.0% 0043666 00436661 1/1   lo-hydrolase/oxidoreductase             
   8::164    4e-25 32.4% 0050873 00508731 1/1   lo-hydrolase/oxidoreductase             
   3::267  3.1e-24 27.2% 0050210 00502101 1/1   lo-hydrolase/oxidoreductase             
   4::176  3.1e-24 26.6% 0051638 00516381 1/1   lo-hydrolase/oxidoreductase             
   1::163  3.9e-22 28.8% 0039825 00398251 1/1   lo-hydrolase/oxidoreductase             
   1::565


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MSDIKIISLGGVRENAKNMYAVEVDDEIFILDCGLKYPENELLGIDFVIPDFSYLRENSRKIVGVFLTHG
00511941   1/1  ---MkltflGtggsvpvpgrngnsylietlddgggriLiDcG....eg.......llrqllalgldpkki
00510221   1/1  ---mkitflgvgg..gtnsylivdetgggailiDpg.........gadallealkalgl...kidaillT
00515911   1/1  ---MkltflgtgsslpvperggnsylietggkriLiDcGlglleqllrgidp............kdidav
00363631   1/1  pkllelteladgvyvitlilplgglgesggnsylietgggailiDtgltfpdae........pllaalke
00464651   1/1  mllevapgvyllrlldlellvlglggvlevgqgnnsyli.tggkaiLiDpg......lsagadallaalk
00512751   1/1  --sklvevadgvylvrgpdpkitplgglgefldvglgtnsylie.gggaiLiDpglsgdaeg........
00519801   1/1  ppsgemkitflgvgggqg.nsylietggkaiLiDtGlgfplssgrlsrllllrlplvdlfllgadeilpa
00480731   1/1  ---slglfevapgvlvlrfldlggltelggnsylietgggaiLiDpglgpgf........aeallaalka
00507261   1/1  ---itflGtgg....ggpsylletggeriLiDaG....eg..........tlrallrkllkidaiflTHg
00521411   1/1  ---MkltflGtggsvptpgrngssylletpldgggkriLiDcG....eg.......llrqllalgidpsk
00451851   1/1  ---mkitflgsgsglpevadgvyvvrgldlgglgevggnsylietgggaiLiDtglslgdae........
00502521   1/1  ladllllllliadgvlllrelapgvyvldlgglgetglggnsylietgggaiLiDpglg......egadr
00457331   1/1  ----gleildglalvevapgvylvlgflplggltvlggnsylietgggaiLiDpGlgpgf........ae
00478431   1/1  ---dlplllallllglglfevapgvyllrvldlggltglggnsylietgggaiLiDpG........lgpg
00427831   1/1  ---mkitvlgvgs..gtnsylvetgdggeailiDpg..dad..........allaalkalglkidaillT
00511021   1/1  ---mkvtvlGsgdggglPqwnclcklcrlvrgidlgllggtgnsylietdggrliLfDtgp....diraf
00518631   1/1  -----------------------nllltggkaiLiDpglglralllllallgl.............davl
00487161   1/1  aapllgllvpglyrlklgdmkvtvldvgtllldlgalfgvvplelapglliiplpglgglggnsylietg
00436661   1/1  M...kitflgagsalpvplllpgallevadgvyvldgvggnsylietgggaiLiDtglg......pdada
00508731   1/1  -------rdlspteladgvyalggngelggnsylivtdggavLidagpspalaeal........laalkk
00502101   1/1  --kmkitflg......gnsylietggkailiDpg...............pllaalgidplkidavllTHa
00516381   1/1  ---MkltflgsgsavpdpgplgelggnsylietggkaiLiDtGlg......ldadallealkelgldped
00398251   1/1  M...kitvlgagsevadnvypltvlggnsylietgggaiLiDpglg......gsadallaalkalgldpe


                         -         -         *         -         -         -         -:140
query           HADAIGALPYFVSEFDVPVFGSELTIELAKIACENEEDARKFDDFHVIDESTEIDFENATISFFQTTHSI
00511941   1/1  daiflTHlHaDHigGlpgllltllllgrfpplpiygppgtaelleallkdsglllgfplrfheledgetl
00510221   1/1  HaHaDHigglpalleafgapvyapegtaellral............drpledgdtlelggltvevlptpg
00515911   1/1  llTHlHaDHigglplllrallllgllllrfpnapvyappgtaelleallkl.....pllrvielddgetl
00363631   1/1  lgkkidaillTHgHaDHigglpylle.pgapiyaseltaellkaklpe........plvtlkdgdtltlg
00464651   1/1  al.iglkdidavllTHaHaDHigglpallerfpgapiyapegtaellka.....llglpflpvreledgd
00512751   1/1  llealkal.lglkdidavllTHaHaDHigglpalleafpgapvyapegtaellra.....lllllllpvr
00519801   1/1  lkelgi..dkidaillTHaHaDHigglpellkrfpnapvyapkataellkdklkllfategfspllpall
00480731   1/1  llgkdidavllTHaHaDHigglpallea.gapiyapegtael.......llllglplpvreledgdtlel
00507261   1/1  HaDHigGlpgllltlllllgarkpglpiygppgtlelleallklsglllgfplilellplelieledget
00521411   1/1  idaiflTHlHaDHigGlpgllktllllgrgpplpiygppgtaelleallkdsglllefplevheledgev
00451851   1/1  allealkelgpkdidavllTHgHaDHigglpaller.gapiyaseltaellkal.......glvlpditl
00502521   1/1  llealkal.iglkdidavllTHaHaDHigglpalleafnpgapiyapegtaellkallk.......plpv
00457331   1/1  allealkalglkdidavllTHaHaDHigglpallea.gapvyapegtaellrall.......pplpvrel
00478431   1/1  laeallaalkellglkidavllTHaHaDHigglpallea.gapiyapegtaellrallkl....lpplpv
00427831   1/1  HgHaDHigglpelakatgapvyapeetaell..............pdrtledgdtltlggltvevlhtpg
00511021   1/1  adallenlkalgidlsdidavvlsHahpDHigglpallelfpapvyaspgtaellkallpllflldllgl
00518631   1/1  lTHaHaDHigglpalle..gapvyappgtaellrslladaglllylllgvlplllpvieledgdtlelgg
00487161   1/1  ggaiLiDpGlgldaarllg..allealkalgldpedidavllTHaHaDHigglpalleatfpgapvyape
00436661   1/1  llaalkalgldpedidavllTHaHaDHigglpellkrpgapvyaseataellralladagalygerlllp
00508731   1/1  lglkpvdavllTHgHaDhvgglpyllea.gapiyaseataell......kellkvllaslgpllgeiapl
00502101   1/1  HaDHi.glpallealpa..............................lkdgdtlelggltvtvlpaghtp
00516381   1/1  idavllTHlHlDHigglpll...pnapvyaheataelledlllllalllglllvlallpdilledgdtle
00398251   1/1  didaillTHlHaDHigglpellefpgapvyaheaeaellr......dplkllralylfglllplialpdr


                         +         -         -         -         -         *         -:210
query           PESLGVVIKTENGNVVYTGDFKFDQSAEKGYRTDYARLTEIGREGVLALLSESANAENPRETVNERAIYD
00511941   1/1  elggltvtaipvpHt.pgslgyrietk......tgdgkfdveklkelglplgpllgllkegvlvlledgt
00510221   1/1  Htpgslglli..pggkvlftGDtlfipgigrlpggdlaallesl.ekllal.....pddtlvlpgHgptl
00515911   1/1  elggltvtalpagHt.pgslgyrietgggkvlfsGDtgfspe...........llelak.gadllileat
00363631   1/1  gltvevlhtgpghtpgsvvlyl..pegkvlftGDllfsggtgrldlgdleqlleslekllellldatlv-
00464651   1/1  tlelggltvtvlptpglHtpgslgllie.dgg.vlftGDtlf........spdpglldllgdadvliles
00512751   1/1  eledgdtlelggltvevlptpglHtpgslgllie.dgg.vlftGDtlfsgglgridlglggddllileat
00519801   1/1  akgiplrvievkdgdtlelggltievlptpgHtpgsvgyyieedlngdslvllielgggkvlftGDtlfs
00480731   1/1  ggltvevlptppgHtpgslglli..pggkvlftGDtlfsgglgridllp---------------------
00507261   1/1  lelggltvtviptpHteapgsvgyrieekdrlgkfealglppgpllgklklgddvvllietpggkvlftG
00521411   1/1  lelggltvtalpvpHtp.gslgyrieekalpgkldveklkalglppgplygklkeglsvtledggvilgs
00451851   1/1  edgdtltlggltvevlhtgpghtpgslvlll..pdgkvlftGDllfsgg---------------------
00502521   1/1  ielddgdtlelggltitvlptpglHtpgslglli....gkvlftGDtlfsgglgriledlpegdlealll
00457331   1/1  edgdtlelggltvevlptppgHt.pgslglli..pggkvlftGDtlfig---------------------
00478431   1/1  reledlgdtlelggltv.vlptpgHtpgslglli..pggkvlftGDtlf---------------------
00427831   1/1  HtpghvsylledeggsdplvlftGDtlfvggigrtdlgdaeqllasllekllalpddtlvypgHgptlsn
00511021   1/1  plpvivlkdgetlelgllggltvtalhtpghtpghl.pedkilfsgdsfglliedlpgggrvlftGDtlp
00518631   1/1  ltvtvlptpgHtpgslgllietpggrvlftGDtlfs.....gdlpdgdllallesldadllllestylvv
00487161   1/1  gtaellrdllldllalqelvgellglleelllpllpalpvreledgdtlelG.lev--------------
00436661   1/1  alpdrtledgdtltlggltlevlhtpgHtpgslgllle..dgkvlftGDtlfvgglg...ridlllpeag
00508731   1/1  tlvlplvvledgetlelgglevta----------------------------------------------
00502101   1/1  ghgdltpgslgflietpggkilftGDtlfs........pdlgrldelgg..advlileatgg.......d
00516381   1/1  lgg..levlhtpgHtpghlgflleeggggkvlftGD----------------------------------
00398251   1/1  lledgdtlelggltlevlhtpGH-----------------------------------------------


                         -         -         -         +         -         -         -:280
query           FISENFEYRKGRIIVACVASNILRVQQIFNAAAANNRKVALTGHDVEKVVKTAMRLNKLVLPEEDLLIPI
00511941   1/1  vilpsdvlgper..........................................................
00510221   1/1  snletvlallllndhlearldevvallasglatlpillalalalnlflrllgrsll--------------
00515911   1/1  ygdrllavgg............................................................
00363631   1/1  ----------------------------------------------------------------------
00464651   1/1  gygdalhplftgdheellesl.erllslaldpkvvipgH-------------------------------
00512751   1/1  yglvdvllpp...........hhmsvleslekllallld-------------------------------
00519801   1/1  pelgllaegplldad.......................................................
00480731   1/1  ----------------------------------------------------------------------
00507261   1/1  Dtlfgp.......ldlar.......gadllihEat...................................
00521411   1/1  avlelplgggkvlfsGDtgps...........dellelae.gadlliheat...................
00451851   1/1  ----------------------------------------------------------------------
00502521   1/1  igeltydtllhps...........hetlleslekllal.dpkvvi-------------------------
00457331   1/1  ----------------------------------------------------------------------
00478431   1/1  ----------------------------------------------------------------------
00427831   1/1  lkflaavepli....................dhlrhrld-------------------------------
00511021   1/1  fp..........eellealek.idvllldttfadpiemiipghglktgr.....................
00518631   1/1  pghg------------------------------------------------------------------
00487161   1/1  ----------------------------------------------------------------------
00436661   1/1  lpdgdpealleslerllal.--------------------------------------------------
00508731   1/1  ----------------------------------------------------------------------
00502101   1/1  hstleealeallelkpkrvipgHgstlilafalerleellaale.glgvevlvlllg-------------
00516381   1/1  ----------------------------------------------------------------------
00398251   1/1  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           KKINDYNDDEIVILETGRSGEPLKSLQKMAMGRHRFVNLHEGDLVFITTTPSHAMETKVARTRDMIYRSG
00511941   1/1  ........................................................pgkkvlfsgDtlps
00510221   1/1  ----------------------------------------------------------------------
00515911   1/1  ......................................................................
00363631   1/1  ----------------------------------------------------------------------
00464651   1/1  ----------------------------------------------------------------------
00512751   1/1  ----------------------------------------------------------------------
00519801   1/1  ......................................................................
00480731   1/1  ----------------------------------------------------------------------
00507261   1/1  ......................................................................
00521411   1/1  ......................................................................
00451851   1/1  ----------------------------------------------------------------------
00502521   1/1  ----------------------------------------------------------------------
00457331   1/1  ----------------------------------------------------------------------
00478431   1/1  ----------------------------------------------------------------------
00427831   1/1  ----------------------------------------------------------------------
00511021   1/1  ......................................................................
00518631   1/1  ----------------------------------------------------------------------
00487161   1/1  ----------------------------------------------------------------------
00436661   1/1  ----------------------------------------------------------------------
00508731   1/1  ----------------------------------------------------------------------
00502101   1/1  ----------------------------------------------------------------------
00516381   1/1  ----------------------------------------------------------------------
00398251   1/1  ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           ADVKAIFDELNSSGHASKNDLQLMMNLVKPRYVIPVQGEYRMLSAHAELARELGIPSENIFLLKKGDVLE
00511941   1/1  pe.........llellrgadvlihEatfgdellelakgsgHltleealellkalgpkrlvltHgsprygd
00510221   1/1  ----------------------------------------------------------------------
00515911   1/1  .............................ghstleealellkalgpkrlvltHgspry.dleelleelae
00363631   1/1  ----------------------------------------------------------------------
00464651   1/1  ----------------------------------------------------------------------
00512751   1/1  ----------------------------------------------------------------------
00519801   1/1  .......................................................vlivghhghmslees
00480731   1/1  ----------------------------------------------------------------------
00507261   1/1  ..................................................fldd....elaigggHltle
00521411   1/1  ......................................................................
00451851   1/1  ----------------------------------------------------------------------
00502521   1/1  ----------------------------------------------------------------------
00457331   1/1  ----------------------------------------------------------------------
00478431   1/1  ----------------------------------------------------------------------
00427831   1/1  ----------------------------------------------------------------------
00511021   1/1  ...................................................................dmp
00518631   1/1  ----------------------------------------------------------------------
00487161   1/1  ----------------------------------------------------------------------
00436661   1/1  ----------------------------------------------------------------------
00508731   1/1  ----------------------------------------------------------------------
00502101   1/1  ----------------------------------------------------------------------
00516381   1/1  ----------------------------------------------------------------------
00398251   1/1  ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           YKKDEMTISSSVEVGNTMIDGTGVGDIGNIVLRDRKILSEDGIFIAVVTIDRKKRKIVDTPKITSRGFVY
00511941   1/1  ella------------------------------------------------------------------
00510221   1/1  ----------------------------------------------------------------------
00515911   1/1  a---------------------------------------------------------------------
00363631   1/1  ----------------------------------------------------------------------
00464651   1/1  ----------------------------------------------------------------------
00512751   1/1  ----------------------------------------------------------------------
00519801   1/1  l---------------------------------------------------------------------
00480731   1/1  ----------------------------------------------------------------------
00507261   1/1  eal-------------------------------------------------------------------
00521411   1/1  .---------------------------------------------------------------------
00451851   1/1  ----------------------------------------------------------------------
00502521   1/1  ----------------------------------------------------------------------
00457331   1/1  ----------------------------------------------------------------------
00478431   1/1  ----------------------------------------------------------------------
00427831   1/1  ----------------------------------------------------------------------
00511021   1/1  hh--------------------------------------------------------------------
00518631   1/1  ----------------------------------------------------------------------
00487161   1/1  ----------------------------------------------------------------------
00436661   1/1  ----------------------------------------------------------------------
00508731   1/1  ----------------------------------------------------------------------
00502101   1/1  ----------------------------------------------------------------------
00516381   1/1  ----------------------------------------------------------------------
00398251   1/1  ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:560
query           IKTSKDLMVESRDIVAKIVQRDLDNKEFDWSQLKQDIRENLNNFLYEQTKRHPVILPVIMEINQNNHFSK
00511941   1/1  ----------------------------------------------------------------------
00510221   1/1  ----------------------------------------------------------------------
00515911   1/1  ----------------------------------------------------------------------
00363631   1/1  ----------------------------------------------------------------------
00464651   1/1  ----------------------------------------------------------------------
00512751   1/1  ----------------------------------------------------------------------
00519801   1/1  ----------------------------------------------------------------------
00480731   1/1  ----------------------------------------------------------------------
00507261   1/1  ----------------------------------------------------------------------
00521411   1/1  ----------------------------------------------------------------------
00451851   1/1  ----------------------------------------------------------------------
00502521   1/1  ----------------------------------------------------------------------
00457331   1/1  ----------------------------------------------------------------------
00478431   1/1  ----------------------------------------------------------------------
00427831   1/1  ----------------------------------------------------------------------
00511021   1/1  ----------------------------------------------------------------------
00518631   1/1  ----------------------------------------------------------------------
00487161   1/1  ----------------------------------------------------------------------
00436661   1/1  ----------------------------------------------------------------------
00508731   1/1  ----------------------------------------------------------------------
00502101   1/1  ----------------------------------------------------------------------
00516381   1/1  ----------------------------------------------------------------------
00398251   1/1  ----------------------------------------------------------------------


                         -         -         -         *         -         -         -:630
query           KKKKG-----------------------------------------------------------------
00511941   1/1  ----------------------------------------------------------------------
00510221   1/1  ----------------------------------------------------------------------
00515911   1/1  ----------------------------------------------------------------------
00363631   1/1  ----------------------------------------------------------------------
00464651   1/1  ----------------------------------------------------------------------
00512751   1/1  ----------------------------------------------------------------------
00519801   1/1  ----------------------------------------------------------------------
00480731   1/1  ----------------------------------------------------------------------
00507261   1/1  ----------------------------------------------------------------------
00521411   1/1  ----------------------------------------------------------------------
00451851   1/1  ----------------------------------------------------------------------
00502521   1/1  ----------------------------------------------------------------------
00457331   1/1  ----------------------------------------------------------------------
00478431   1/1  ----------------------------------------------------------------------
00427831   1/1  ----------------------------------------------------------------------
00511021   1/1  ----------------------------------------------------------------------
00518631   1/1  ----------------------------------------------------------------------
00487161   1/1  ----------------------------------------------------------------------
00436661   1/1  ----------------------------------------------------------------------
00508731   1/1  ----------------------------------------------------------------------
00502101   1/1  ----------------------------------------------------------------------
00516381   1/1  ----------------------------------------------------------------------
00398251   1/1  ----------------------------------------------------------------------