[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for lsal0:ABD99526.1


[Show Plain Result]

## Summary of Sequence Search
   1::75
   4::77   1.1e-26 62.2% 0052706 00527061 1/1   like                                    
   1::75


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MSKRQSFYQFLMTERNPDSTDEIAQFANNAFYDQSFPKQADDYDSLSQYLELNGTYLPSMVIFDNAWTKY
00527061   1/1  ---rksFyqflltlrnpkskdevaelAnnafldlsFPkqskdydelsdYlelnadyllslsifdeaWeeY


                         -         -         *         -         -         -         -:140
query           EEFMS-----------------------------------------------------------------
00527061   1/1  leelker---------------------------------------------------------------