[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for lsal0:ABD99574.1


[Show Plain Result]

## Summary of Sequence Search
   1::203
 105::174  2.5e-08 29.9% 0044201 00442011 1/1   e finger endonucleases                  
   1::203


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MRIKLNPKIINWLEENVPGRPWKETFRMFKQEFPDLEWSLDSMKHSCYRRGIRNEIDSRYKKGHKSWCAG
00442011   1/1  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           MKGLRIPGSEKGWFNEGRRPPNERPLGSERKYGKYTLVKVKRDGSKYEKWKPKQVHIWEQHNGPLPKGYI
00442011   1/1  ----------------------------------Ylvvglnld..gkgktylvhrlvalafignipeglv


                         +         -         -         -         -         *         -:210
query           ITFIDGDKSNLNIDNLACIKKSVNGAMNIKSLRSESPELFKVRVAQIELDQKIKKITKNLGSD-------
00442011   1/1  vdHidgnklnnridNLrwvtrsen.lrnakkrgl------------------------------------