[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for lsal0:ABD99636.1


[Show Plain Result]

## Summary of Sequence Search
   1::298
  68::296  4.2e-78 48.2% 0042443 00424431 1/1   ouridine synthase                       
  77::299  2.2e-76 48.4% 0050102 00501021 1/1   ouridine synthase                       
  82::282  1.6e-51 43.4% 0050199 00501991 1/1   ouridine synthase                       
  84::277  3.4e-48 45.2% 0047872 00478721 1/1   ouridine synthase                       
  81::268  2.3e-47 40.0% 0043606 00436061 1/1   ouridine synthase                       
  42::290  3.1e-46 27.6% 0052542 00525421 1/1   ouridine synthase                       
  13::120  7.1e-21 33.6% 0035794 00357941 1/1   -L RNA-binding motif                    
  71::243  6.1e-18 23.6% 0051811 00518111 1/1   ouridine synthase                       
  13::120  2.7e-15 28.7% 0037616 00376161 1/1   -L RNA-binding motif                    
   8::111  7.4e-12 24.0% 0036496 00364961 1/1   -L RNA-binding motif                    
  11::68   1.7e-10 40.4% 0044787 00447871 1/1   -L RNA-binding motif                    
  12::70   3.9e-09 41.4% 0047871 00478711 1/1   -L RNA-binding motif                    
  81::243  7.7e-09 22.4% 0039976 00399761 1/1   ouridine synthase                       
  82::182  1.6e-05 22.9% 0043107 00431071 1/1   ouridine synthase                       
   1::298


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MSDYKVLADKTGRLDKVVTNIFTDYTRSQLKKMIDDGNIKVNGDVKKANYKVNLGDEITFDKPEVKKLSL
00424431   1/1  -------------------------------------------------------------------eel
00501021   1/1  ----------------------------------------------------------------------
00501991   1/1  ----------------------------------------------------------------------
00478721   1/1  ----------------------------------------------------------------------
00436061   1/1  ----------------------------------------------------------------------
00525421   1/1  -----------------------------------------dllllklllkvlgkllvlvllltplglgv
00357941   1/1  ------------kklseyglqlrekqklrffYgltekqllnyfkealklkgvtglnllqllerRLDkvla
00518111   1/1  ----------------------------------------------------------------------
00376161   1/1  ------------krylgPklklirrlgrellltgkygllnkkellkreyppgqhgqlarkklslyllqlr
00364961   1/1  -------ellemRLDkvlyragfaktrslArqlvehGhvlvnGkrvkPsylvkvgdvitvregskellvv
00447871   1/1  ----------gmRLdkflarlgla.srseakklieagrVlvngkvvtkpsykvkpgdvievdgkllep--
00478711   1/1  -----------lRLdkflaelgll.sRseakklikagrVtvngkvvtkpslkvkpgdvitvdgellelle
00399761   1/1  ----------------------------------------------------------------------
00431071   1/1  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           EPENIPLDIVYEDDDVIVVNKPQGMVVHPSPGHFEHTLVNALLYHSPLSTINGTYRPGIVHRIDKDTSGL
00424431   1/1  lvevlgldilyededllvlnKPagllvhpgdgllrgtlldlllallgd..lggllrlypvhRLDkdTsGl
00501021   1/1  ------ldilyedddllvlnKPagllvhpgdgllrgtlldlllall......glprlypvhRLDrdTsGl
00501991   1/1  -----------edddllvlnKPagllvhpgdgl.rgtlldlllallg.......lrlylvhRLDkdTsGl
00478721   1/1  -------------ddllvlnKPagllvhpgdgl.grtlldlllall.......lprlypvhRLDrdTsGl
00436061   1/1  ----------yeddgllvldKPagltshpvvgklrrll..............gvkkvghvgrLDpdtsGv
00525421   1/1  lpedrplkvlyedg.llvldKPagltshdvvgkvkrtl..............glkkaghvGtLDplasGv
00357941   1/1  rlglaksrrqArqlilhGhVlVngkvvdkpsykVkpgdvitvdgkslsll--------------------
00518111   1/1  glvlelglkvdpeldvlvlgrplklllldg.vllldKPagvtShdvvakvr.rlldll............
00376161   1/1  ekqklrffygllerqllryfklarklkgvtglnllqlLErRLdkvlfrlg--------------------
00364961   1/1  vlallelrrgapealllyeekleglvlrlpereelplpine-----------------------------
00447871   1/1  ----------------------------------------------------------------------
00478711   1/1  ----------------------------------------------------------------------
00399761   1/1  ----------yllngillldKPagltshdvvallk..............rllgvkkvghaGtLDplatGv
00431071   1/1  -----------llnglllldKPsgltshdvvallkrll..............gvkkvghaGtLDplatGv


                         +         -         -         -         -         *         -:210
query           LMVAKNDMAHQSLAKQLKDKTNTREYVALVHGNIKEDSGTIDAPLGRSKVDRKKQAVVKDGRNAVTHFEV
00424431   1/1  lllakdgeaarrlseqfpkreveKtYlalvegvpped.glidlplgvllddglklavledgkpavtlfrv
00501021   1/1  lllakdgeaarrlselfperkveKtYlAlvagvpeeeegtilaplvrlpdgrlklavvvleggkpavtry
00501991   1/1  lllakdgelarrl..lfpkrkveKtYlalvlgvlteellglldlg............vlldgkpaltlya
00478721   1/1  lllakdgeaarrl..lfpkrkveKtYlalvagvlteellgtldag............vvldgkpavtlfa
00436061   1/1  Lvlalgg.atkllsyllk...vdKtYlalvllglatdtgdidgeiletlgrdpltrekiekllasflgei
00525421   1/1  Lvvalge..atklvkylldvd..KeYvalvrlgvatdtgdlegeileftgeilqvpPlrsavkrdgrray
00357941   1/1  ----------------------------------------------------------------------
00518111   1/1  .kvghvGtLDplatGvLllalgg.atkllspll...dvdKtYlatvrlvgliteealekllagftgeilq
00376161   1/1  ----------------------------------------------------------------------
00364961   1/1  ----------------------------------------------------------------------
00447871   1/1  ----------------------------------------------------------------------
00478711   1/1  ----------------------------------------------------------------------
00399761   1/1  Lllalge..atkllsylldad..KtYvatvllGlatdtldaegeiletadvhlteedleealakflgeil
00431071   1/1  Lllalgk..atkllsyllda..dKtYvatvllglatdtldae----------------------------


                         -         -         -         +         -         -         -:280
query           LKRYGDYTLVKCVLETGRTHQIRVHMKYIGHPLVGDQLYGPRKTLGNSGQFLHAEKLGFVHPRTNEYLEF
00424431   1/1  lerlgglslveltlltGRtHQiRvhlaalghpilgDplYggllllllllllllrlkrlgigrlaLhAyrl
00501021   1/1  rvlerlgglslveltlltGRtHQiRvhlaalghpilgdprygigellldlllaggllkrlaLhAlrLsfl
00501991   1/1  vlerl.glslleltlltGrthqiRvhlaalghpilgdkrygignlllgld..lhagelrfltplellll.
00478721   1/1  vlerl.glslleltlltGrthqiRvhlaalghpvlgdkrygignllllgrlalgawrllflhellll---
00436061   1/1  lqvPPlysavkvnGkrlYelaregvevelearkvaitslellefdgplglslvelrve------------
00525421   1/1  elarkglevelpllllevtcskG..tyiRslvhdlglpLgcgAhvseLrRtrvgpftlddaltledlall
00357941   1/1  ----------------------------------------------------------------------
00518111   1/1  vPpmysavkvd........arpvtiyelellef-------------------------------------
00376161   1/1  ----------------------------------------------------------------------
00364961   1/1  ----------------------------------------------------------------------
00447871   1/1  ----------------------------------------------------------------------
00478711   1/1  ----------------------------------------------------------------------
00399761   1/1  qvPPlySavkvngkrlyelareGievelklrlv-------------------------------------
00431071   1/1  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           TAPLPENFKKLLESLDKR----------------------------------------------------
00424431   1/1  sfphpltgelreltap------------------------------------------------------
00501021   1/1  hpltgellefeaplpedfl---------------------------------------------------
00501991   1/1  ..--------------------------------------------------------------------
00478721   1/1  ----------------------------------------------------------------------
00436061   1/1  ----------------------------------------------------------------------
00525421   1/1  allllfelpl------------------------------------------------------------
00357941   1/1  ----------------------------------------------------------------------
00518111   1/1  ----------------------------------------------------------------------
00376161   1/1  ----------------------------------------------------------------------
00364961   1/1  ----------------------------------------------------------------------
00447871   1/1  ----------------------------------------------------------------------
00478711   1/1  ----------------------------------------------------------------------
00399761   1/1  ----------------------------------------------------------------------
00431071   1/1  ----------------------------------------------------------------------