[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for lsal0:ABD99654.1


[Show Plain Result]

## Summary of Sequence Search
   1::429
 230::428  0.00026 19.1% 0053395 00533952 2/2   myosin                                  
 258::336   0.0033 26.6% 0053440 00534402 2/2   myosin                                  
 132::225     0.63 21.3% 0053395 00533951 1/2   myosin                                  
 153::231      2.6 22.8% 0053440 00534401 1/2   myosin                                  
   1::429


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MNSSKKVFIGVENLRKEIFAAAILAGIILTGARSQSVQAEVLSTDSNNVTEVETSKVANNKQLTQNISMS
00533952   2/2  ----------------------------------------------------------------------
00534402   2/2  ----------------------------------------------------------------------
00533951   1/2  ----------------------------------------------------------------------
00534401   1/2  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           KENQTHDSSSMVSAGETSDVNEVQENKSETISNDMSDLQVQLTSLYVDLQPKQMAFKTVAATNDAKSILV
00533952   2/2  ----------------------------------------------------------------------
00534402   2/2  ----------------------------------------------------------------------
00533951   1/2  -------------------------------------------------------------mdaikkklq
00534401   1/2  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           STKSTKQKAKKILDDKKKDLDTAKCNLDKTNKALANTQIKVTVNQEVAKNAQKELDSLNADLTAKQADYD
00533952   2/2  ----------------------------------------------------------------------
00534402   2/2  ----------------------------------------------------------------------
00533951   1/2  alklekenaldraeeaeaklkeaesrlekleeelaalkkklglleeeldeaeerleeaerkleeaekrle
00534401   1/2  ------------mdaikkklqalklekenaldraelaeeklkeleeelekleeelaslqkklklledeld


                         -         -         -         +         -         -         -:280
query           KADKDLNDAKVNYQVKKAILASTKEDKSKLKKELANAEEKQTSAKKVFKTSKKKLTSLKEKVAQAKEDLD
00533952   2/2  -------------------mdaikkklqalklekenaldraeeaeaklkeaesrlekleeelaalkkklg
00534402   2/2  -----------------------------------------------mdaikkklqalklekenaldrae
00533951   1/2  kaeselaslerriql-------------------------------------------------------
00534401   1/2  kaeeeLkealekLeeaekklt-------------------------------------------------


                         -         *         -         -         -         -         +:350
query           KVQAKLAKDQKNEQKAKENIAKLEADIKTKQADYDKAKQEISTKQEALKKSQTELAEQKKVKAHAKKVLD
00533952   2/2  lleeeldeaeerleeaerkleeaekrlekaeselaslerriqlleeeleraeerldtaeqkleeaekrad
00534402   2/2  laeeklkeleeelekleeelaslqkklklledeldkaeeeLkealekLeeaekklt--------------
00533951   1/2  ----------------------------------------------------------------------
00534401   1/2  ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           KANKELIKVQATVQDKQAKLKELQDQFGNYVGDDDELADTKKSLTEAQTKLTQAQKNQADAQKDYDKAQA
00533952   2/2  eseralkvlenrlledeerlellEeqlkeaeriaeeaerkyeevarklavvedeleraeerlelaesklq
00534402   2/2  ----------------------------------------------------------------------
00533951   1/2  ----------------------------------------------------------------------
00534401   1/2  ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           DYETKLKKH-------------------------------------------------------------
00533952   2/2  eleeelki--------------------------------------------------------------
00534402   2/2  ----------------------------------------------------------------------
00533951   1/2  ----------------------------------------------------------------------
00534401   1/2  ----------------------------------------------------------------------