[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for lsal0:ABD99672.1


[Show Plain Result]

## Summary of Sequence Search
   1::375
   8::245    3e-62 42.0% 0052117 00521171 1/1   ne nucleotide alpha hydrolases-like     
   4::250  1.1e-50 35.2% 0046213 00462131 1/1   ne nucleotide alpha hydrolases-like     
   4::196  3.5e-50 37.2% 0039977 00399771 1/1   ne nucleotide alpha hydrolases-like     
   8::196  3.1e-46 40.1% 0047035 00470351 1/1   ne nucleotide alpha hydrolases-like     
   6::188  8.3e-45 36.9% 0050233 00502331 1/1   ne nucleotide alpha hydrolases-like     
   5::269  1.3e-44 33.6% 0051038 00510381 1/1   ne nucleotide alpha hydrolases-like     
   8::219  2.3e-36 31.7% 0050746 00507461 1/1   ne nucleotide alpha hydrolases-like     
   7::191  7.3e-33 30.4% 0047848 00478481 1/1   ne nucleotide alpha hydrolases-like     
   8::256  2.5e-32 26.5% 0045391 00453911 1/1   ne nucleotide alpha hydrolases-like     
   7::202  7.8e-32 36.5% 0049476 00494761 1/1   ne nucleotide alpha hydrolases-like     
   8::249  5.7e-31 21.7% 0048858 00488581 1/1   ne nucleotide alpha hydrolases-like     
   8::224  2.4e-26 28.7% 0048369 00483691 1/1   ne nucleotide alpha hydrolases-like     
   4::188  1.8e-20 25.0% 0050128 00501281 1/1   ne nucleotide alpha hydrolases-like     
   4::194  8.5e-15 23.4% 0052363 00523631 1/1   ne nucleotide alpha hydrolases-like     
   7::130  9.1e-10 25.0% 0043381 00433811 1/1   ne nucleotide alpha hydrolases-like     
   8::188  3.7e-09 25.9% 0050739 00507391 1/1   ne nucleotide alpha hydrolases-like     
   8::128  8.6e-08 27.2% 0051645 00516451 1/1   ne nucleotide alpha hydrolases-like     
   5::130  3.8e-07 18.9% 0039538 00395381 1/1   ne nucleotide alpha hydrolases-like     
   1::375


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MKDKSQIRVVVGMSGGVDSSVSAYLLKQQGYDVVGVFMKNWDDKNDSGVCTVTEDYQDVAKVASQIGIPY
00521171   1/1  -------lgggkkvvvllSGGvDSsvaaallkkagyeviavhfdyglrtde..lcvseeeledakklaek
00462131   1/1  ---rrywdlpfvpdleellealvellrdavrkrlvgdkkvvvalSGGlDSsvlaallkeaggaegllfmk
00399771   1/1  ---iavlrrlmsgkkvvvalSGGlDSsvllallkelgyeviavtvdlg........qrhsedleaareva
00470351   1/1  -------eellerlveairdylllvgdkkvvvglSGGvDSsvlaallkkalgyevlavtvdtgl......
00502331   1/1  -----kkkvvvalSGGlDSsvalallkeagyeviavtvdlgqre..........dleaarevakklgivp
00510381   1/1  ----idleelieelvellrdyvlkrggkkvvvalSGGvDSsvllallakalglevlavtvdtg.......
00507461   1/1  -------ekllkkllkkvekaikdykllvggdkvlvalSGGvDSsvllallkkllkrlpgyelvavhv..
00478481   1/1  ------kkvvvalSGGlDSsvllallkealgyeviavtvdygqre..........eleaarelakklgik
00453911   1/1  -------kvvlglSGGvDStvaaalakkalgrlplellgdellavtv.......dhglss...deedale
00494761   1/1  ------skltldallllpalllalcleklnelledlvaeeilrealeefgdkvvvalSGGkDSsvllhll
00488581   1/1  -------rrYwdlpfldleeavealrellrdavrkrlvsdvpvgvlLSGGlDSslvaalaaralgnvlaf
00483691   1/1  -------eeaiklfrllkkgdkvlvalSGGkDStvllhlllelarrllgfevvavhv.......dhglrg
00501281   1/1  ---gtsgkvlvllSGGiDSpvaayllmkrGvevialhfdlgpltl.eealevvklllkll..........
00523631   1/1  ---lklmkvvvlfSGGkDStlalylalelghevvalltllpee..ldsymfhtvnlelaklqAealglpl
00433811   1/1  ------lkkkvvvlySGGkDSslaLywllkkgyeVvalltlvg..seldsymfhtvnlelaelqaealgl
00507391   1/1  -------gvvlGlSGGvDSalaaalavralgllrlergllnlnvlavtmps.......glssd..sleda
00516451   1/1  -------rvvvsfSgGkDStvllhlalkalrpaglpipvvfl.......dtgyl.fpetyefvdelaerl
00395381   1/1  ----fvldiaglsedeavealrelledavrrrlrgdvpvgvaLSGGvDSslvaalaaralgdvltftigf


                         -         -         *         -         -         -         -:140
query           YSVNFEKEYWDRVFTYFLDEYKNGRTPNPDIMCNKEVKFKAFLDYAMSIDADYIAMGHYAQLRRDEDGRV
00521171   1/1  lgiplivvdld........eifleilkkgetpnpcvlcrr.irlrillelaeelgadviatGhna.....
00462131   1/1  nwdlddevlavtvdygq...sdeledarevaeklGiphhvvdide...eevldalkdvidagetpnpcvl
00399771   1/1  eklgikehhvvdvdlefvedvvltlideykagatpegdypltcalarnliflllaelaeelgadviatGh
00470351   1/1  .lrseeeledaeklaeklgiplivvdideeflealaelf......gptpnpcnlcnr.lrlelllelake
00502331   1/1  lyvvdlseefaeevldpalkayalgegpypltvvlarnlifkalleiakelgadaiatGht.........
00510381   1/1  .lrseeeledarelaeklgiplhvvdid.elf....dalldllgagdtpnpcnicrr.lrlrllyelake
00507461   1/1  ....dhglrgesdeelefvrelaeklgiplivvdvdelf...........laagngpnpcalcrr.lryg
00478481   1/1  phivvdldeeflselvdpaipagalyegnypltcvlcrn.lifklllevaeelgadavatGht.......
00453911   1/1  lakklgidhelvidivdavdaflaal..egvtgpepkdktigniqarlrmvalyalanklgalvlgtgdv
00494761   1/1  lkaglevlavhv.......dtgll.fpetlefaeelaerlgiplivvdldeefae..flallgglsegdp
00488581   1/1  tvgfgq..........sdeleyarevaehlgiehhvvdide...eelldalpdvlaaldtpepvnlrsr.
00483691   1/1  esdeelefvrelaeklgiplivvdldelf...............kglnpcalarr.lryaallevar..g
00501281   1/1  .........................ekylcilckrlm.lriaeklalklgadaivtGes...........
00523631   1/1  ivieisgeyedeved..........................llellkelgveavvtGdilsd........
00433811   1/1  plyllstsl..........................arelevedlvellkelgadavvfGa----------
00507391   1/1  kalaealgiellvvdidpavdallkllgea......gpelkdltlgniqarlRmvllyalanllgglvlg
00516451   1/1  gldlivvrpdeslar.........ggklwekdpd.wccdilkveplkralkelgfdaw------------
00395381   1/1  eg..........ldeleearavaehlgtehhevlitvdallaflpalagal.....dlle----------


                         +         -         -         -         -         *         -:210
query           HLLRGADDNKDQTYFLSQLSQEQLQKVMFPIGHLQKSEVRRIAEEAGLATAKKKDSTGICFIGERNFSKF
00521171   1/1  ...........ddvadqtllnlyalnallglkilrPLlgldKeeirelakelglpeiskypsggcgscfl
00462131   1/1  crr.lrlyllyelarelgadvvltGhgaDelfgGytkygdllkglaplgdlpkdqvyllarllg.llkre
00399771   1/1  t.............lkgadelrfgylrlallpglelraplldllfPllglskaeir--------------
00470351   1/1  lgadvlatGtgad.deietgyltllgd.dgikdlsyvlg.lpeelllklirPlldl--------------
00502331   1/1  ....lddndevrfelyflallpglki...iaPlldlgllellrskeei----------------------
00510381   1/1  lgadvlltGhad....elfegylllrg.dglkg................irPlldlskeevrelarelgl
00507461   1/1  allelakelgadvlatGhha.dDqaetvllnllrgsglkglqgi......llgglrlirPLldltkdeir
00478481   1/1  ......addlddvrferlflallpelgviaplrpllglskaeirelakelg-------------------
00453911   1/1  .....sEtllgyltkygdggld................lrPlldlyKtevralarelglpeeiiekppsa
00494761   1/1  pnpcalcrr.lklepllraakelgadaiatGh....rrddsaerallrllrgd.........--------
00488581   1/1  irlyllarlark.gakvvltGegaDelfgGyptyrpdplarlllldlltlllgvlllrvdrmsmahgl..
00483691   1/1  adalatGhhl...dDqaetvllnllrgsglkglagikelaldggl...........rlirPLlelskeei
00501281   1/1  .....lgqvasqtlenlllidalnlpvlrPLigldkeeiielareigt----------------------
00523631   1/1  ..........yqrlrvegvcarlglkvlaPLwgldqeellrelielgleaiivk----------------
00433811   1/1  ----------------------------------------------------------------------
00507391   1/1  T...gnlsElalgyftkyGdggld................iaPladly----------------------
00516451   1/1  ----------------------------------------------------------------------
00395381   1/1  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           LGEFLPAQPGEMVTLDGEVKGNHFGLMNYTIGQRKGLGIGGDGKSNEPWFVIGKDLKTNTLLVGQGYHNE
00521171   1/1  prnpftkallelle.eaeeildeeglvlglhlgll-----------------------------------
00462131   1/1  iralglelrvPfldeelvelalglpl..aykidgggic..------------------------------
00399771   1/1  ----------------------------------------------------------------------
00470351   1/1  ----------------------------------------------------------------------
00502331   1/1  ----------------------------------------------------------------------
00510381   1/1  peeilekppsadlgf.......gqldeellglpyeeldailevlelgehaglvs.iigl-----------
00507461   1/1  eyakelglp-------------------------------------------------------------
00478481   1/1  ----------------------------------------------------------------------
00453911   1/1  eleplrpgqtdedslglpyrildlilell.....evteekleiver------------------------
00494761   1/1  ----------------------------------------------------------------------
00488581   1/1  ....evrvPfldhrlvefalslppelkpiggltKtllre-------------------------------
00483691   1/1  rayakelglpyied--------------------------------------------------------
00501281   1/1  ----------------------------------------------------------------------
00523631   1/1  ----------------------------------------------------------------------
00433811   1/1  ----------------------------------------------------------------------
00507391   1/1  ----------------------------------------------------------------------
00516451   1/1  ----------------------------------------------------------------------
00395381   1/1  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           HLYANSLDASKLSFVDDISDCGDEFHCTAKFRYRQKDTGVTVKFNEDRTKVEVIFDEPVRAITPGQEVVF
00521171   1/1  ----------------------------------------------------------------------
00462131   1/1  ----------------------------------------------------------------------
00399771   1/1  ----------------------------------------------------------------------
00470351   1/1  ----------------------------------------------------------------------
00502331   1/1  ----------------------------------------------------------------------
00510381   1/1  ----------------------------------------------------------------------
00507461   1/1  ----------------------------------------------------------------------
00478481   1/1  ----------------------------------------------------------------------
00453911   1/1  ----------------------------------------------------------------------
00494761   1/1  ----------------------------------------------------------------------
00488581   1/1  ----------------------------------------------------------------------
00483691   1/1  ----------------------------------------------------------------------
00501281   1/1  ----------------------------------------------------------------------
00523631   1/1  ----------------------------------------------------------------------
00433811   1/1  ----------------------------------------------------------------------
00507391   1/1  ----------------------------------------------------------------------
00516451   1/1  ----------------------------------------------------------------------
00395381   1/1  ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           YDGEECLGSGTIDHAYKESKLLQYV---------------------------------------------
00521171   1/1  ----------------------------------------------------------------------
00462131   1/1  ----------------------------------------------------------------------
00399771   1/1  ----------------------------------------------------------------------
00470351   1/1  ----------------------------------------------------------------------
00502331   1/1  ----------------------------------------------------------------------
00510381   1/1  ----------------------------------------------------------------------
00507461   1/1  ----------------------------------------------------------------------
00478481   1/1  ----------------------------------------------------------------------
00453911   1/1  ----------------------------------------------------------------------
00494761   1/1  ----------------------------------------------------------------------
00488581   1/1  ----------------------------------------------------------------------
00483691   1/1  ----------------------------------------------------------------------
00501281   1/1  ----------------------------------------------------------------------
00523631   1/1  ----------------------------------------------------------------------
00433811   1/1  ----------------------------------------------------------------------
00507391   1/1  ----------------------------------------------------------------------
00516451   1/1  ----------------------------------------------------------------------
00395381   1/1  ----------------------------------------------------------------------