[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for lsal0:ABD99736.1


[Show Plain Result]

## Summary of Sequence Search
   1::252
 132::250  6.1e-09 18.5% 0048674 00486741 1/1   CoA N-acyltransferases (Nat)            
 113::241  1.3e-07 16.9% 0052713 00527131 1/1   CoA N-acyltransferases (Nat)            
 127::250  1.5e-07 19.5% 0051420 00514201 1/1   CoA N-acyltransferases (Nat)            
  82::248  2.3e-07 19.1% 0043712 00437121 1/1   CoA N-acyltransferases (Nat)            
 133::249    6e-07 16.5% 0051493 00514931 1/1   CoA N-acyltransferases (Nat)            
 133::248    6e-07 17.0% 0052040 00520401 1/1   CoA N-acyltransferases (Nat)            
 135::249    1e-06 20.0% 0048433 00484331 1/1   CoA N-acyltransferases (Nat)            
 127::248  2.4e-06 16.8% 0046988 00469881 1/1   CoA N-acyltransferases (Nat)            
 139::250  2.4e-06 19.6% 0050223 00502231 1/1   CoA N-acyltransferases (Nat)            
 140::252  2.4e-06 18.7% 0051492 00514921 1/1   CoA N-acyltransferases (Nat)            
 162::242  2.4e-06 20.0% 0049804 00498041 1/1   CoA N-acyltransferases (Nat)            
 113::252  2.7e-06 18.0% 0049031 00490311 1/1   CoA N-acyltransferases (Nat)            
 160::249  2.9e-06 15.6% 0050940 00509401 1/1   CoA N-acyltransferases (Nat)            
 135::248  3.1e-06 19.5% 0052754 00527541 1/1   CoA N-acyltransferases (Nat)            
 123::253  3.3e-06 16.0% 0050733 00507331 1/1   CoA N-acyltransferases (Nat)            
 124::252  3.7e-06 16.0% 0049311 00493111 1/1   CoA N-acyltransferases (Nat)            
 135::249  6.4e-06 20.0% 0051421 00514211 1/1   CoA N-acyltransferases (Nat)            
 123::249  6.5e-06 15.7% 0052858 00528581 1/1   CoA N-acyltransferases (Nat)            
 117::251  6.6e-06 17.0% 0051377 00513771 1/1   CoA N-acyltransferases (Nat)            
 136::252  8.1e-06 20.5% 0051375 00513751 1/1   CoA N-acyltransferases (Nat)            
 111::252  8.6e-06 19.6% 0049641 00496411 1/1   CoA N-acyltransferases (Nat)            
 133::252  8.6e-06 17.8% 0050185 00501851 1/1   CoA N-acyltransferases (Nat)            
 132::245  9.5e-06 16.4% 0049884 00498841 1/1   CoA N-acyltransferases (Nat)            
 133::245    1e-05 16.7% 0046158 00461581 1/1   CoA N-acyltransferases (Nat)            
 140::252  1.5e-05 16.7% 0046177 00461771 1/1   CoA N-acyltransferases (Nat)            
 124::252  1.9e-05 18.0% 0052874 00528741 1/1   CoA N-acyltransferases (Nat)            
 133::253    2e-05 18.3% 0051232 00512321 1/1   CoA N-acyltransferases (Nat)            
 125::252  2.2e-05 17.2% 0051437 00514371 1/1   CoA N-acyltransferases (Nat)            
 160::241  2.4e-05 25.0% 0052701 00527011 1/1   CoA N-acyltransferases (Nat)            
 111::238  2.7e-05 18.1% 0045986 00459861 1/1   CoA N-acyltransferases (Nat)            
 152::248  2.7e-05 18.9% 0043128 00431281 1/1   CoA N-acyltransferases (Nat)            
 126::250    3e-05 17.6% 0052664 00526641 1/1   CoA N-acyltransferases (Nat)            
 126::248  3.3e-05 18.2% 0051248 00512481 1/1   CoA N-acyltransferases (Nat)            
 117::250  3.5e-05 18.5% 0053292 00532921 1/1   CoA N-acyltransferases (Nat)            
 123::248  3.6e-05 20.7% 0052704 00527041 1/1   CoA N-acyltransferases (Nat)            
 165::252  3.8e-05 16.3% 0052347 00523471 1/1   CoA N-acyltransferases (Nat)            
 133::249  4.4e-05 17.7% 0048876 00488761 1/1   CoA N-acyltransferases (Nat)            
 165::252  6.1e-05 18.4% 0049032 00490321 1/1   CoA N-acyltransferases (Nat)            
 164::248  7.3e-05 20.0% 0048174 00481741 1/1   CoA N-acyltransferases (Nat)            
 165::241  8.4e-05 23.7% 0049338 00493381 1/1   CoA N-acyltransferases (Nat)            
 111::249  9.6e-05 14.9% 0051303 00513031 1/1   CoA N-acyltransferases (Nat)            
 127::241  0.00016 16.8% 0051751 00517511 1/1   CoA N-acyltransferases (Nat)            
 165::241  0.00016 20.8% 0052652 00526521 1/1   CoA N-acyltransferases (Nat)            
 123::241  0.00021 13.8% 0052829 00528291 1/1   CoA N-acyltransferases (Nat)            
 162::248  0.00023 19.8% 0047280 00472801 1/1   CoA N-acyltransferases (Nat)            
 124::241  0.00035 15.3% 0053076 00530761 1/1   CoA N-acyltransferases (Nat)            
   1::252


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MKEQTMQKVHSLFTGWNQTIIWSCLDGTMGQIIVDDDSNPQSALAILGINSAFAFFAGKPNLNLITTAVD
00486741   1/1  ----------------------------------------------------------------------
00527131   1/1  ----------------------------------------------------------------------
00514201   1/1  ----------------------------------------------------------------------
00437121   1/1  ----------------------------------------------------------------------
00514931   1/1  ----------------------------------------------------------------------
00520401   1/1  ----------------------------------------------------------------------
00484331   1/1  ----------------------------------------------------------------------
00469881   1/1  ----------------------------------------------------------------------
00502231   1/1  ----------------------------------------------------------------------
00514921   1/1  ----------------------------------------------------------------------
00498041   1/1  ----------------------------------------------------------------------
00490311   1/1  ----------------------------------------------------------------------
00509401   1/1  ----------------------------------------------------------------------
00527541   1/1  ----------------------------------------------------------------------
00507331   1/1  ----------------------------------------------------------------------
00493111   1/1  ----------------------------------------------------------------------
00514211   1/1  ----------------------------------------------------------------------
00528581   1/1  ----------------------------------------------------------------------
00513771   1/1  ----------------------------------------------------------------------
00513751   1/1  ----------------------------------------------------------------------
00496411   1/1  ----------------------------------------------------------------------
00501851   1/1  ----------------------------------------------------------------------
00498841   1/1  ----------------------------------------------------------------------
00461581   1/1  ----------------------------------------------------------------------
00461771   1/1  ----------------------------------------------------------------------
00528741   1/1  ----------------------------------------------------------------------
00512321   1/1  ----------------------------------------------------------------------
00514371   1/1  ----------------------------------------------------------------------
00527011   1/1  ----------------------------------------------------------------------
00459861   1/1  ----------------------------------------------------------------------
00431281   1/1  ----------------------------------------------------------------------
00526641   1/1  ----------------------------------------------------------------------
00512481   1/1  ----------------------------------------------------------------------
00532921   1/1  ----------------------------------------------------------------------
00527041   1/1  ----------------------------------------------------------------------
00523471   1/1  ----------------------------------------------------------------------
00488761   1/1  ----------------------------------------------------------------------
00490321   1/1  ----------------------------------------------------------------------
00481741   1/1  ----------------------------------------------------------------------
00493381   1/1  ----------------------------------------------------------------------
00513031   1/1  ----------------------------------------------------------------------
00517511   1/1  ----------------------------------------------------------------------
00526521   1/1  ----------------------------------------------------------------------
00528291   1/1  ----------------------------------------------------------------------
00472801   1/1  ----------------------------------------------------------------------
00530761   1/1  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           ACSDLIMVPQNTEWANMIEKYCGEQVRKFTRYATLKDTKFDIPRLQLNIEKLPPEFQIHSIDANLYDQCL
00486741   1/1  -------------------------------------------------------------mmeiirplt
00527131   1/1  ------------------------------------------erltirpatpeDleallellneafveef
00514201   1/1  --------------------------------------------------------Pedleallallrel
00437121   1/1  -----------MltiRpatpeDlpallellvdafpetyatvltldnlrrwlfkisvlkiliddlisillp
00514931   1/1  --------------------------------------------------------------glmslmtm
00520401   1/1  --------------------------------------------------------------IRatpedl
00484331   1/1  ----------------------------------------------------------------gmpptl
00469881   1/1  --------------------------------------------------------mtiRpatpeDlpel
00502231   1/1  --------------------------------------------------------------------mi
00514921   1/1  ---------------------------------------------------------------------H
00498041   1/1  ----------------------------------------------------------------------
00490311   1/1  ------------------------------------------erltirpatpeDleallallneafeall
00509401   1/1  ----------------------------------------------------------------------
00527541   1/1  ----------------------------------------------------------------plptle
00507331   1/1  ----------------------------------------------------tmrltirpatpeDleall
00493111   1/1  -----------------------------------------------------mrltirpatpeDleall
00514211   1/1  ----------------------------------------------------------------tiRpat
00528581   1/1  ----------------------------------------------------mmnitirpatpeDleail
00513771   1/1  ----------------------------------------------MpptleterltlRpatpeDleall
00513751   1/1  -----------------------------------------------------------------dltir
00496411   1/1  ----------------------------------------rltiRpatpeDleallalladafveeyall
00501851   1/1  --------------------------------------------------------------rltirpat
00498841   1/1  -------------------------------------------------------------rltirpatp
00461581   1/1  --------------------------------------------------------------pttmriti
00461771   1/1  ---------------------------------------------------------------------k
00528741   1/1  -----------------------------------------------------erltirpatpeDleall
00512321   1/1  --------------------------------------------------------------lelllevf
00514371   1/1  ------------------------------------------------------Meirirpadledllal
00527011   1/1  ----------------------------------------------------------------------
00459861   1/1  ----------------------------------------gtirpatlspeDleallallneafveefgl
00431281   1/1  ----------------------------------------------------------------------
00526641   1/1  -------------------------------------------------------ltirpatpeDleall
00512481   1/1  -------------------------------------------------------itirpatpeDleall
00532921   1/1  ----------------------------------------------rltirpatpeDleallallndafv
00527041   1/1  ----------------------------------------------------pmditirpatpeDlpall
00523471   1/1  ----------------------------------------------------------------------
00488761   1/1  --------------------------------------------------------------Miiirpat
00490321   1/1  ----------------------------------------------------------------------
00481741   1/1  ----------------------------------------------------------------------
00493381   1/1  ----------------------------------------------------------------------
00513031   1/1  ----------------------------------------mltirpatpeDleallallreafavlgael
00517511   1/1  --------------------------------------------------------mtmditirpatpeD
00526521   1/1  ----------------------------------------------------------------------
00528291   1/1  ----------------------------------------------------mmditirpatpedleall
00472801   1/1  ----------------------------------------------------------------------
00530761   1/1  -----------------------------------------------------mdltirpatpeDlpail


                         +         -         -         -         -         *         -:210
query           QKEWSTDLVGNYSNYNEFKKLGLGYVIVNDQSIVAGASSFSSYQNGIEIEVATHPDFQRRGLATIACSQL
00486741   1/1  padldallellaaagpadglavvellvllellgplldrgtlfvalddgelvGfialipygepfafiglli
00527131   1/1  .lplsleelrefled....pgalllvaeddgelvGfaglslidpgtaeigrlavdpeyrgkGiGkallea
00514201   1/1  feaplseeeseelleelledg......lflvaeddgelvGfaglrpddggvaeigrlavdpeyrgkGiGr
00437121   1/1  gllllllsgdfrllgtfvaltrdidhytnfylilsedlakleellkaldlidwsqgllisslnlrlievi
00514931   1/1  ditirpatpeDleallellrevfpeelpplsleelrellad.pgalflvaeddgelvGfarlrplpdggv
00520401   1/1  eallellreafpeeylllllelllell...pgalflvaeddgelvGfarlrpldsllllgggvaeigrla
00484331   1/1  eterltlRpatpeDaeallallreadpevarllpflgpplsleelraflerllaaealdpgglflvaedd
00469881   1/1  ldallallrdafaellalllpeplseeeleellerl.ledladpgalflvaeddgelvGfaglrpdddep
00502231   1/1  tirpapeDlpallallreafvellallllaplseelslerlrellad....pgglllvaedddGelvGfa
00514921   1/1  ltirpatpeDleallallndafveeylllppplteeeslerlrelladp....gslllvaeddgelvGfa
00498041   1/1  ---------------------glflvaeddgeivGfaglrpddsglagdllgllllglllllglllllll
00490311   1/1  gllppptleellerlleadpgglllvaedkedgelvGfaglrpidslllgggvaeigylavdpeyrgkGi
00509401   1/1  -------------------mmdmsditirpatpeDleallallreafpeeeplsledlralledpgalfl
00527541   1/1  terltlRpatpeDleallallndaevellggplspedleeflerllerlad.pgalllvaedkedgelvG
00507331   1/1  allreafaellallglpplseeeseeflrelladpgalllvaeddgelvGfaglrpdddetgggrpvaei
00493111   1/1  allaeafpelgeplsleelrellad....pgalllvaeddgelvGfaglslldslllgldgggvaeiegl
00514211   1/1  peDleallallndafveeyllpfppplsleeleerlrellad....gdg.llvaeddtgelvGfaglrpi
00528581   1/1  ellreafrdtyafllspevlealgfdeglplseaeslerlrelledpgglflvaeddgkivGfialspdg
00513771   1/1  allaeapevlrylpplseeellerlrelladpgslflvaeddgelvGfaglrpidagegvaeigylavdp
00513751   1/1  patpeDleallalladafveeylllfppplsleelralleella.....pgslllvaeddgelvGfaglr
00496411   1/1  lpappldaellaerslerlrellad....ggalllvaeddgelvGfaglrpldsllalpgggvaeigyla
00501851   1/1  peDleallalladafaeelylgfpeplsleelralleel..lpgglflvaededgelvGfaglrpiddgp
00498841   1/1  eDleallallndafvelylglllllafelaplsleellerlrelladgga....lllvaeddgeplvGfa
00461581   1/1  rpatpeDleallallreafvelpldpplsledlrelledp....galllvaeddgelvGfarlrpldsll
00461771   1/1  miemrltirpatpeDleallellreafaefypelpplsleelrelladp....galflvaeddgelvGfa
00528741   1/1  allndafveeylpalpeplsleelrayler.ladpgslflvaeddgelvGfaglrpiddeplggvaeigl
00512321   1/1  pepyseelledlld.....psalvlvaeddgelvGfarlipdggdvaeigdlaVlpeyrgkGiGsaLlea
00514371   1/1  lreafveefallppplsledlrelledpgalflvaeddgelvGfaalrpldggvaeigrlavdpeyrgkG
00527011   1/1  -------------------ltlrpltpedaeallallndafvalyllgpppplsleelrerleedlgggl
00459861   1/1  lppldeeeslellrellad.pgalllvaeddgelvGfaglrplddlplgldvaeigdlavdpeyrgkGiG
00431281   1/1  -----------ellelldlpgslffvaeddgeivGfarlrpldddvaeieslaVdpeyrgqGiGkkLlea
00526641   1/1  allaeafaelylglppplsleellallaellpgglflvaeddgelvGfaglrpldslllgggvaeiggla
00512481   1/1  allreaf..lseeelrallpgglllvaeddgeivGfaallpldpdvaeigrlaVapeyrgkGiGkaLlea
00532921   1/1  eeyaglppplsleelrellae...............adpgalflvaedakedgepgepelvGfaglrpid
00527041   1/1  allraafretyalllsaeqlealldeaeslerlrellpgalvlvaeddgeivGfaal....ggvaeierl
00523471   1/1  ------------------------lvaeddggelvGfaglrpiddgpggklvaeigglavdpeyrGkGiG
00488761   1/1  pedleailallrevfpeelplsleelrdlld...pgalllvaeddgelvGfarllp.ggdvaeigrlaVd
00490321   1/1  ------------------------lvaeddgelvGfarlrplpggdvaeigrlavdpeyrgkGiGraLle
00481741   1/1  -----------------------yltirpatpeDleallallreafveppesledleelladppalllva
00493381   1/1  ------------------------fvied.dgelvGfiglrridpengtaeigywvdpsyrGkGiateal
00513031   1/1  pppsleellerllddpgll....flvaeddgelvGfarlrpdgdepvaeigrlaVdpeyrgkGiGraLle
00517511   1/1  leallallneafaelylfllspesleallerll..pgalflvaeddgelvGfallspidslpgggtaeie
00526521   1/1  ------------------------faiedkedgeliGfiglrridpengtaeigywlapeyqgkGyatea
00528291   1/1  allaeafaeelallll...pgalllvaeddgeivGfalllplggvayieslaVdpeyrgqGiGraLleaa
00472801   1/1  ---------------------alflvaedeedgelvGfaglrplpdpvlglggvaeigdlavdpeyrgkG
00530761   1/1  allaeafaeelalllpeeplsleelaallapgalllvaeddgelvGfalllpldsgdvaelgdlaVapea


                         -         -         -         +         -         -         -:280
query           IITCLDQSLYPSWDAHTEISLHLAQKLGYQFAYKYLAYEIEE----------------------------
00486741   1/1  vhpdyrgrGigralleaalerlpgrplvllpeanpallal------------------------------
00527131   1/1  lleyakerlglkrlylevledNeaairlYek---------------------------------------
00514201   1/1  aLlealleyarelglrrlvlevladNeaairfYeklGFev------------------------------
00437121   1/1  kelaaskglkvellratlllvlprelafllelpevpdg--------------------------------
00514931   1/1  aeigrlaVdpeyrgkGiGraLleallelarelglkrlvl-------------------------------
00520401   1/1  vdpeyrgkGiGraLleallelarelglkrlvlev.npa--------------------------------
00484331   1/1  gelvGfaglrpiddeggvaeiglavapeyrGkGiGtell-------------------------------
00469881   1/1  ggpvaeigylavdpeyrgkGiGraLlealleyarel.g--------------------------------
00502231   1/1  glrpdddlplgggvaeigdlavdpeyrgkGiGraLleall------------------------------
00514921   1/1  glrpldslllpgggvaeigglavdpeyrgkGiGraLlealle----------------------------
00498041   1/1  llpgggvaeigrlaVdpeyrGkGiGraLleal--------------------------------------
00490311   1/1  GraLlealleyarelglkrlvlevlpdNeaairlYeklGFe.----------------------------
00509401   1/1  vaeddgelvGfarlrpdddlpdvaeigrlaVdpeyrgkG-------------------------------
00527541   1/1  fvglrpideggvaeiglavapeyrGkGigtellealle--------------------------------
00507331   1/1  gylavdpeyrgkGiGraLlealleyarelgrrlvlevladNea---------------------------
00493111   1/1  yVlpeyrgrGiGraLlaallewarerGarrlvlevlpdNtaa----------------------------
00514211   1/1  ddgplglgvaeiglavdpeyrgkGiGtaLlealleyare-------------------------------
00528581   1/1  vlllglllllsllpggkvaeigrlaVdpeyrGkGiGsaL-------------------------------
00513771   1/1  eyrGkGiGtallealleyafrelglrrlvlevdadNeaair-----------------------------
00513751   1/1  piddepgggvaeigglavdpeyrgkGigtallealleyarel----------------------------
00496411   1/1  vdpeyrgkGiGraLlealleyarelglrrlvlevdpdNeaai----------------------------
00501851   1/1  agggvaeiglavdpeyrgkGigtallealleyarelglrrlv----------------------------
00498841   1/1  glrpidsegggvaeigglavdpeyrgkGiGraLle-----------------------------------
00461581   1/1  llllllllllpggdvaeigrlavdpeyrgkGiGra-----------------------------------
00461771   1/1  rlrpdgdervaeigrlaVdpeyrgkGiGraLleallelarer----------------------------
00528741   1/1  avdpeyrgkGiGtallealleyarelglkrivlevdpdNeaa----------------------------
00512321   1/1  lleyakelglkriylevladn.paiklYeklGFvpvgelklyy---------------------------
00514371   1/1  iGraLleallelarerglrrlvlevlvlpdNeaairlyeklG----------------------------
00527011   1/1  lfvaedd.gelvGfvglrpdpdggvaeigyl---------------------------------------
00459861   1/1  raLleallelarelglkrlvlevladNe------------------------------------------
00431281   1/1  lleyarelglkrill..npaaikfyeklGFevvgelkl--------------------------------
00526641   1/1  vdpeyrgkGiGraLlealleyarerglrrlvlevlpdNea------------------------------
00512481   1/1  llelarelglkrlvlevladntaaialYeklGFevvge--------------------------------
00532921   1/1  spggggvaeigylavdpeyrgkGiGraLlealleyarelg------------------------------
00527041   1/1  yVhpdyrgrGiGraLlealeelarergarrltlev.ne--------------------------------
00523471   1/1  taLlealleyarer.glrrlvlevdpdNeaairlYeklGFee----------------------------
00488761   1/1  peyrgkGiGraLleallelarelglkrlvlevneaairf-------------------------------
00490321   1/1  alleearelglkrlvlev.neaairfYeklGFeevgelplyy----------------------------
00481741   1/1  eddgelvGfaglrplddegrvaeigylavdpeyrgkGi--------------------------------
00493381   1/1  kalldyafeelglrrieatvladNeaSirly---------------------------------------
00513031   1/1  alleyareelglrrlvlevdne.airfYeklGFeevgel-------------------------------
00517511   1/1  glaVdpeyrgkGiGsaLleallelarelglk---------------------------------------
00526521   1/1  lkalldyafeelglhrieatvdpdNlaSirv---------------------------------------
00528291   1/1  eeearerglkrlylevdnpaairlYeklGFe---------------------------------------
00472801   1/1  iGraLleallelarelglrrlvlev.neaairfYeklG--------------------------------
00530761   1/1  rGrGiGraLlealeelarerlgarrlrlevl---------------------------------------