[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for lsal0:ABD99739.1


[Show Plain Result]

## Summary of Sequence Search
   1::578
  71::319  6.8e-35 24.3% 0053093 00530931 1/1   lo-dependent hydrolases                 
  71::318  7.2e-20 21.0% 0051086 00510861 1/1   lo-dependent hydrolases                 
  71::264  1.5e-18 25.4% 0048115 00481151 1/2   lo-dependent hydrolases                 
  18::121  4.5e-17 25.3% 0053092 00530921 1/1   site domain of metallo-dependent hydrol 
  10::333    6e-15 45.3% 0037043 00370431 1/1   site domain of metallo-dependent hydrol 
  12::364  9.3e-15 35.6% 0041948 00419481 1/1   site domain of metallo-dependent hydrol 
  18::360  9.2e-13 33.3% 0047005 00470051 1/1   site domain of metallo-dependent hydrol 
  19::358  1.1e-11 28.9% 0047518 00475181 1/1   site domain of metallo-dependent hydrol 
  20::360  1.2e-11 36.5% 0047004 00470041 1/1   site domain of metallo-dependent hydrol 
  19::357  2.3e-11 35.2% 0044456 00444561 1/1   site domain of metallo-dependent hydrol 
  70::320  1.4e-10 23.6% 0047785 00477851 1/1   lo-dependent hydrolases                 
  40::327  1.1e-09 25.9% 0045709 00457091 1/1   lo-dependent hydrolases                 
 288::343  1.7e-09 33.9% 0041367 00413671 1/1   site domain of metallo-dependent hydrol 
  40::331  4.4e-09 24.9% 0047865 00478651 1/1   lo-dependent hydrolases                 
  71::328  8.5e-09 22.1% 0039934 00399341 1/1   lo-dependent hydrolases                 
  70::320  9.7e-08 23.2% 0052760 00527601 1/1   lo-dependent hydrolases                 
  71::320  5.4e-07 19.0% 0052789 00527891 1/1   lo-dependent hydrolases                 
  71::321  9.9e-07 22.4% 0051353 00513531 1/1   lo-dependent hydrolases                 
  18::70   1.1e-06 30.2% 0040833 00408331 1/1   site domain of metallo-dependent hydrol 
  71::318  1.1e-06 17.3% 0047519 00475191 1/1   lo-dependent hydrolases                 
 283::319    4e-06 43.2% 0048480 00484802 2/2   lo-dependent hydrolases                 
 283::319  5.9e-05 40.5% 0048612 00486122 2/2   lo-dependent hydrolases                 
  68::316  0.00013 20.3% 0051670 00516701 1/1   lo-dependent hydrolases                 
 289::319  0.00023 38.7% 0048115 00481152 2/2   lo-dependent hydrolases                 
  62::328  0.00024 24.4% 0051799 00517991 1/1   lo-dependent hydrolases                 
 283::319  0.00037 45.9% 0049957 00499572 2/2   lo-dependent hydrolases                 
 283::319   0.0012 43.2% 0051379 00513792 2/2   lo-dependent hydrolases                 
  71::103     0.36 27.3% 0048612 00486121 1/2   lo-dependent hydrolases                 
  71::103      1.1 36.7% 0048480 00484801 1/2   lo-dependent hydrolases                 
  71::103      1.8 36.4% 0049957 00499571 1/2   lo-dependent hydrolases                 
  71::103      4.8 30.3% 0051379 00513791 1/2   lo-dependent hydrolases                 
   1::578


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MEKQKLIKLIDVAAGRKKADLVLKNAKIVDVFQAKILTGDIAISDGYIAGIGGSYQGVVECNYTGKYVAP
00530931   1/1  ----------------------------------------------------------------------
00510861   1/1  ----------------------------------------------------------------------
00481151   1/2  ----------------------------------------------------------------------
00530921   1/1  -----------------mfdllikngtvvdg.....lvadiaikdgkIaaigslleasaaevidasGlll
00370431   1/1  ---------mkisrlayadllgpttgdlvrladtdllaevekdltlygeelvfgggkvlrdgmglsvaaa
00419481   1/1  -----------vaaleesmllllkngrvvdp..gvlvkadvliadgkIaaigsnipadllpgaevidasG
00470051   1/1  -----------------mmdllikngrvvdp..dgllvadvliedgkIaaigedlsapeaaevidasgll
00475181   1/1  ------------------ldlliknalvltldddlledgdvlieggrIaavg.klpaaevidasgklvmP
00470041   1/1  -------------------dllikngtvvdpdg..llvadvliedgkIaaigenleapegaeviDatGll
00444561   1/1  ------------------mdlliknarivtpdg.viedgdvliedgkIaaigeglllllaaaevidaegl
00477851   1/1  ---------------------------------------------------------------------P
00457091   1/1  ---------------------------------------tdflknPKvelhlhldgslspetllelaien
00413671   1/1  ----------------------------------------------------------------------
00478651   1/1  ---------------------------------------tdiknlPKvelhlhldgslspetllelaikn
00399341   1/1  ----------------------------------------------------------------------
00527601   1/1  ---------------------------------------------------------------------P
00527891   1/1  ----------------------------------------------------------------------
00513531   1/1  ----------------------------------------------------------------------
00408331   1/1  -----------------mldllikngtvvdgtgglllaadvliedgrIvavgdllalsaaevidasGllv
00475191   1/1  ----------------------------------------------------------------------
00484802   2/2  ----------------------------------------------------------------------
00486122   2/2  ----------------------------------------------------------------------
00516701   1/1  -------------------------------------------------------------------llp
00481152   2/2  ----------------------------------------------------------------------
00517991   1/1  -------------------------------------------------------------dllnvlkvd
00499572   2/2  ----------------------------------------------------------------------
00513792   2/2  ----------------------------------------------------------------------
00486121   1/2  ----------------------------------------------------------------------
00484801   1/2  ----------------------------------------------------------------------
00499571   1/2  ----------------------------------------------------------------------
00513791   1/2  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           GFIEAHIHIESSYVSPEEFSRVFIPRGTTTILADPHEIVNVAGLKGLDYMVNAAKNAKMDIRYMMPPCVP
00530931   1/1  GlIDtHvHliepfletleevleaalaaGVttvvdagg.....tglenfeamlelaekyplrvlaflnisv
00510861   1/1  GliDlHvHlrepglehkedlesgtraaaagGvttvidmpntippvtglealeaylelaeekslvdylftg
00481151   1/2  GfIDlHvHl.pgqvlkedfataalagGvTtvvd.........gpcgtspapdtpea..lelllelaegvp
00530921   1/1  vlPGflevGkdaDltifdldpellllkdgvtplvglellglpvltivrGkv-------------------
00370431   1/1  demadlliknarivdgdg..ivkadiaikdGrIaaigkalepplldgvdlivgsateviDaeGkivtPG.
00419481   1/1  klvlP.................................................................
00470051   1/1  vlP...................................................................
00475181   1/1  ......................................................................
00470041   1/1  vlPGl.................................................................
00444561   1/1  lvlP..................................................................
00477851   1/1  GlIDtHvHlrepll.glefkedlesgtraaaagGvttvvdmpntvppittlealeayleraeeaap.vnv
00457091   1/1  giilplgtleelaevidasgklvlpgfidahthldqvltggaedlarltkevledwledgvvylElrlsp
00413671   1/1  ----------------------------------------------------------------------
00478651   1/1  giilplgtleelaevidasgklvlpgfidaHthldqtllrgledladltyevledwledgvlylElrfsp
00399341   1/1  gfvdlHvHldktltlglrlplalgtllealaltaelkklltaedlleraeqllelalasGvtai.rthvd
00527601   1/1  GliDsHvHlrepflglelkedlesgtraaaagGvttvvdmpntlppidtleallalleraeealyvdvgf
00527891   1/1  GlIDtHvHldepglgdgefledlesgtaaaaagGvttvvvmpntvpgtdtldglleslelrllalaee.k
00513531   1/1  GliDlhvhlrepfgglehkedfesgtraAaagGvttvvdmpntlpvtdtlealeaklelaeg.kayvdyg
00408331   1/1  ----------------------------------------------------------------------
00475191   1/1  GlidtHtHldqtllrglaldlsllewlelytfplealltpedlyaaallallellrsGvttvedfgtlh.
00484802   2/2  ----------------------------------------------------------------------
00486122   2/2  ----------------------------------------------------------------------
00516701   1/1  gliDaHvHlddpgfdedleevlarakaagvttivvvgtd......ledfekllelaekyp.nvyaalGvh
00481152   2/2  ----------------------------------------------------------------------
00517991   1/1  tllllldlmnqsellefikklpkvelhvhldgslspetlidlagklvlpglidththldqtllrglfgdl
00499572   2/2  ----------------------------------------------------------------------
00513792   2/2  ----------------------------------------------------------------------
00486121   1/2  GlIDlHvHlyggggedgfdaetletglrallra-------------------------------------
00484801   1/2  GfiDlHvHggggvdfndad...letvlrallaa-------------------------------------
00499571   1/2  GfiDlHvHGgggvdfndgsvegletllrallra-------------------------------------
00513791   1/2  GfiDlhvHGgggvdfndaelnlslegletlaea-------------------------------------


                         +         -         -         -         -         *         -:210
query           ATNFETSGADLYADDMEDALKTGEVDGLAELMNFPGVINADDKMIDEILMAKKYGARIDGHAPQVVGKDL
00530931   1/1  vglhpldflgdgdeltleelaelikvvaigeiGLklfmdysavieaqkevleaalelakelkdlpvvvHv
00510861   1/1  gltpglal.........eelaelvalg.vaglklfmdggllvvddevlrralelakelglpvlvHaedpd
00481151   1/2  avdyeffgaytdaleglkellnvaalvghgalkvfvmgydgvlatdde.levmlraleeale.aG.alGl
00530921   1/1  ----------------------------------------------------------------------
00370431   1/1  ......................................................................
00419481   1/1  ......................................................................
00470051   1/1  ......................................................................
00475181   1/1  ......................................................................
00470041   1/1  ......................................................................
00444561   1/1  ......................................................................
00477851   1/1  gplggltll......egenleelaelakeaGaiglklymtdsglgvvddellrealelaaelglpvlvha
00457091   1/1  eelallallalldellssGtttvr.dvdgig........dalaeaaeelgirarlifcilrllpeearet
00413671   1/1  ----------------------------------------------------------------------
00478651   1/1  edvalsaalalllellrsgvttvedvsgig........dalaeaaeelgirarlilgilrhlpe......
00399341   1/1  idt.vgleglkallelleelkgrldlqivafpqlgilsledale...lleealalga.dlvgglppseed
00527601   1/1  hpglt.gl.......ngeeleelrellkaaGaiglklyltysdlgvaddeelrellelaaelglpvivHa
00527891   1/1  vyvdvglhpgltplrllvmgdrgetleelrelaeaiGai.Glklyltysglgvqdeelrrllelaaelgl
00513531   1/1  fhgaltglngee......laelaelvaeagvvafkefmsydgllvvddevlrralelakelglpvlvHae
00408331   1/1  ----------------------------------------------------------------------
00475191   1/1  ........dalaeaaeelgirav.lglvlmdrpppdalsleealelleealgagglvvvglaphspytvs
00484802   2/2  ----------------------------------------------------------------------
00486122   2/2  ----------------------------------------------------------------------
00516701   1/1  ...plevdelaeevldeleelleelrpkvvaiGei.Gldyylsksplelqlevfraqlelakelglpvii
00481152   2/2  ----------------------------------------------------------------------
00517991   1/1  lewletftlplevllteedlyrlallaleelladGvttvelrfdpyylhtgygldledvvealleglral
00499572   2/2  ----------------------------------------------------------------------
00513792   2/2  ----------------------------------------------------------------------
00486121   1/2  ----------------------------------------------------------------------
00484801   1/2  ----------------------------------------------------------------------
00499571   1/2  ----------------------------------------------------------------------
00513791   1/2  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           NAYIAAGPANDHECSTLEEAEERLARGMYLLLREGSVTQDLRKLLPIVNTANSRRCLLSGDDVQAKTAIN
00530931   1/1  rdapedlleilelleegdiviHcfhgsaagilvaeeatllelalealelGvyidigggstfknakalrea
00510861   1/1  lieglleegvtslrlhlhsrpaeaeaaaiaralllarltglrlhivhvstaealeliraakakglnvtae
00481151   1/2  .stdld.yvpavhaedeelialakalaklglgspvhllsgppslaealeraiel----------------
00530921   1/1  ----------------------------------------------------------------------
00370431   1/1  ......................................................................
00419481   1/1  ......................................................................
00470051   1/1  ......................................................................
00475181   1/1  ......................................................................
00470041   1/1  ......................................................................
00444561   1/1  ......................................................................
00477851   1/1  ed...edliellleglanegifdsvlhlfsrpaeaeaeaidralelaretglplhithistaealelire
00457091   1/1  lelalklgadli......vgvdlvgderg.fspellrelllafelarelglpvtiHagEtgd........
00413671   1/1  ----------------------------------------------------------------------
00478651   1/1  .ealellelalklgadlvggvdlpgdep.gfspellylyrelfelarelglpvtiHagEtgdeg.gllda
00399341   1/1  rstteeslkalfelAekygllvdiHvdetldpgsrvletlaeiaealgllgrvlisHatslsslseeeve
00527601   1/1  ededliddlleilleeglt.ggvlhlfsrpaeaelealalglllasftglplhivhvst..kealeliea
00527891   1/1  pvivHaedadliddlleilkeeg.ilggvlhlfsgpaeaEavaaaraldlarypglplhithlstkeale
00513531   1/1  ...dgdlidillegllnegitgprlhllsrpaeaeaeavaralllaeltgaplhivhvstaealelirea
00408331   1/1  ----------------------------------------------------------------------
00475191   1/1  p.ellravlelarelglpvhiHlaetldevrpvelleelgllgprtllaHcvhlsdeeiellaetgvvvv
00484802   2/2  ----------------------------------------------------------------------
00486122   2/2  ----------------------------------------------------------------------
00516701   1/1  Htrd.apedlleilkelgldlrvvlHcftgsleealalldlgvyisisgvvtfkraeelrellkaipldr
00481152   2/2  ----------------------------------------------------------------------
00517991   1/1  lgefgidldl..ivaflrevpls..peealelielalklgdlvvgidlvgae...fspellralfelare
00499572   2/2  ----------------------------------------------------------------------
00513792   2/2  ----------------------------------------------------------------------
00486121   1/2  ----------------------------------------------------------------------
00484801   1/2  ----------------------------------------------------------------------
00499571   1/2  ----------------------------------------------------------------------
00513791   1/2  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           KGHLDNSIRICIDEGLNPITAIQMATLNPAEYCGLNDRGAIAPGRRADMVVFESLEDFAVEETYILGEKL
00530931   1/1  lk.igldrllleTDapyltprnepvysllvalslalllg-------------------------------
00510861   1/1  ttphhLlltdedlgglgtlakcnPplrseedrealwea--------------------------------
00481151   1/2  ----------------------------------------------------------------------
00530921   1/1  ----------------------------------------------------------------------
00370431   1/1  .....................................................-----------------
00419481   1/1  ...........................................GliepgkdADlvlldp..dllveeviv
00470051   1/1  .........................................gslavGadADlvlvdpdalltvdaetlls
00475181   1/1  ......................................GsleeGklADlvlldldaphllplhnllshlv
00470041   1/1  .................................................ADlvvvdpdalltisaellls
00444561   1/1  ..........................................GsievGkdADlvlldld..llvlltivg
00477851   1/1  akaegllvtaevtphhllltredlldgglllgtlakclPp------------------------------
00457091   1/1  ..plelldalgllgad.rigHgvhltede.....lLidllaeagigl-----------------------
00413671   1/1  -------ldiiiknGtivtadgisradellkdgeltlveaalitrsntaellglrdrGhlavG-------
00478651   1/1  lgllgadrigHgvhltedelLidllaeagigvvvcPtsnlklglvsgladh-------------------
00399341   1/1  ellkllaeagi...svvvlPlsnlylqgredtvpvlrgvtpvkellda----------------------
00527601   1/1  akalglrvtaettphhlllteedllelgialgtlakllPp------------------------------
00527891   1/1  liraapleglnvtaetdphhLlltpedlavaesllrdlvl------------------------------
00513531   1/1  karglnvtaevtphhLlldeedledlglegalykvnPPlRs-----------------------------
00408331   1/1  ----------------------------------------------------------------------
00475191   1/1  hcPtsnlklgsgiapvrelldaGvnvglgtDgpasnps--------------------------------
00484802   2/2  --tllealrnlvkllglsleealrmaTlnPArllglddk-------------------------------
00486122   2/2  --tlldavlnlvkllglsleealrmatlnPAkilglddk-------------------------------
00516701   1/1  llleTDaPylaplpyrgkrnepaylplvaealaelr----------------------------------
00481152   2/2  --------elvrergllsleeavrlltsnpAkilglpdr-------------------------------
00517991   1/1  lglpvtiHagEtg..........glrpveyladalgllgadrigHgvh----------------------
00499572   2/2  --tlldavrnlvellglslaealrmaTlnpArllglddr-------------------------------
00513792   2/2  --tlleavrnlvkllglsleealrmatlnPAkllglddr-------------------------------
00486121   1/2  ----------------------------------------------------------------------
00484801   1/2  ----------------------------------------------------------------------
00499571   1/2  ----------------------------------------------------------------------
00513791   1/2  ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           SQGNEYLGEVNYYPIDSVESSMHVKDFTREKLQLHLNSDKVRAIGVVPGEVLTTEEHVTVKRDGDGNFVY
00530931   1/1  ----------------------------------------------------------------------
00510861   1/1  ----------------------------------------------------------------------
00481151   1/2  ----------------------------------------------------------------------
00530921   1/1  ----------------------------------------------------------------------
00370431   1/1  ----------------------------------------------------------------------
00419481   1/1  rGelvaadgeltvl--------------------------------------------------------
00470051   1/1  klkntpfegl------------------------------------------------------------
00475181   1/1  ysang.dv--------------------------------------------------------------
00470041   1/1  kvdytpfegl------------------------------------------------------------
00444561   1/1  Gklvydd---------------------------------------------------------------
00477851   1/1  ----------------------------------------------------------------------
00457091   1/1  ----------------------------------------------------------------------
00413671   1/1  ----------------------------------------------------------------------
00478651   1/1  ----------------------------------------------------------------------
00399341   1/1  ----------------------------------------------------------------------
00527601   1/1  ----------------------------------------------------------------------
00527891   1/1  ----------------------------------------------------------------------
00513531   1/1  ----------------------------------------------------------------------
00408331   1/1  ----------------------------------------------------------------------
00475191   1/1  ----------------------------------------------------------------------
00484802   2/2  ----------------------------------------------------------------------
00486122   2/2  ----------------------------------------------------------------------
00516701   1/1  ----------------------------------------------------------------------
00481152   2/2  ----------------------------------------------------------------------
00517991   1/1  ----------------------------------------------------------------------
00499572   2/2  ----------------------------------------------------------------------
00513792   2/2  ----------------------------------------------------------------------
00486121   1/2  ----------------------------------------------------------------------
00484801   1/2  ----------------------------------------------------------------------
00499571   1/2  ----------------------------------------------------------------------
00513791   1/2  ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           NDQEDVTKIVVVERHHNTGNVNVNLLSGYGIKAGAIAISIGHDSHNIIATGTNDDDIFMAVNELIKQEGG
00530931   1/1  ----------------------------------------------------------------------
00510861   1/1  ----------------------------------------------------------------------
00481151   1/2  ----------------------------------------------------------------------
00530921   1/1  ----------------------------------------------------------------------
00370431   1/1  ----------------------------------------------------------------------
00419481   1/1  ----------------------------------------------------------------------
00470051   1/1  ----------------------------------------------------------------------
00475181   1/1  ----------------------------------------------------------------------
00470041   1/1  ----------------------------------------------------------------------
00444561   1/1  ----------------------------------------------------------------------
00477851   1/1  ----------------------------------------------------------------------
00457091   1/1  ----------------------------------------------------------------------
00413671   1/1  ----------------------------------------------------------------------
00478651   1/1  ----------------------------------------------------------------------
00399341   1/1  ----------------------------------------------------------------------
00527601   1/1  ----------------------------------------------------------------------
00527891   1/1  ----------------------------------------------------------------------
00513531   1/1  ----------------------------------------------------------------------
00408331   1/1  ----------------------------------------------------------------------
00475191   1/1  ----------------------------------------------------------------------
00484802   2/2  ----------------------------------------------------------------------
00486122   2/2  ----------------------------------------------------------------------
00516701   1/1  ----------------------------------------------------------------------
00481152   2/2  ----------------------------------------------------------------------
00517991   1/1  ----------------------------------------------------------------------
00499572   2/2  ----------------------------------------------------------------------
00513792   2/2  ----------------------------------------------------------------------
00486121   1/2  ----------------------------------------------------------------------
00484801   1/2  ----------------------------------------------------------------------
00499571   1/2  ----------------------------------------------------------------------
00513791   1/2  ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:560
query           AVVVKDEKVISRMELKIAGLMCNLPAEKMIAQQDALDEAVHEELGVPDNVNPVMTLSFMPLAVIPKLKIT
00530931   1/1  ----------------------------------------------------------------------
00510861   1/1  ----------------------------------------------------------------------
00481151   1/2  ----------------------------------------------------------------------
00530921   1/1  ----------------------------------------------------------------------
00370431   1/1  ----------------------------------------------------------------------
00419481   1/1  ----------------------------------------------------------------------
00470051   1/1  ----------------------------------------------------------------------
00475181   1/1  ----------------------------------------------------------------------
00470041   1/1  ----------------------------------------------------------------------
00444561   1/1  ----------------------------------------------------------------------
00477851   1/1  ----------------------------------------------------------------------
00457091   1/1  ----------------------------------------------------------------------
00413671   1/1  ----------------------------------------------------------------------
00478651   1/1  ----------------------------------------------------------------------
00399341   1/1  ----------------------------------------------------------------------
00527601   1/1  ----------------------------------------------------------------------
00527891   1/1  ----------------------------------------------------------------------
00513531   1/1  ----------------------------------------------------------------------
00408331   1/1  ----------------------------------------------------------------------
00475191   1/1  ----------------------------------------------------------------------
00484802   2/2  ----------------------------------------------------------------------
00486122   2/2  ----------------------------------------------------------------------
00516701   1/1  ----------------------------------------------------------------------
00481152   2/2  ----------------------------------------------------------------------
00517991   1/1  ----------------------------------------------------------------------
00499572   2/2  ----------------------------------------------------------------------
00513792   2/2  ----------------------------------------------------------------------
00486121   1/2  ----------------------------------------------------------------------
00484801   1/2  ----------------------------------------------------------------------
00499571   1/2  ----------------------------------------------------------------------
00513791   1/2  ----------------------------------------------------------------------


                         -         -         -         *         -         -         -:630
query           DKGLVDVEKNAFVSNELD----------------------------------------------------
00530931   1/1  ----------------------------------------------------------------------
00510861   1/1  ----------------------------------------------------------------------
00481151   1/2  ----------------------------------------------------------------------
00530921   1/1  ----------------------------------------------------------------------
00370431   1/1  ----------------------------------------------------------------------
00419481   1/1  ----------------------------------------------------------------------
00470051   1/1  ----------------------------------------------------------------------
00475181   1/1  ----------------------------------------------------------------------
00470041   1/1  ----------------------------------------------------------------------
00444561   1/1  ----------------------------------------------------------------------
00477851   1/1  ----------------------------------------------------------------------
00457091   1/1  ----------------------------------------------------------------------
00413671   1/1  ----------------------------------------------------------------------
00478651   1/1  ----------------------------------------------------------------------
00399341   1/1  ----------------------------------------------------------------------
00527601   1/1  ----------------------------------------------------------------------
00527891   1/1  ----------------------------------------------------------------------
00513531   1/1  ----------------------------------------------------------------------
00408331   1/1  ----------------------------------------------------------------------
00475191   1/1  ----------------------------------------------------------------------
00484802   2/2  ----------------------------------------------------------------------
00486122   2/2  ----------------------------------------------------------------------
00516701   1/1  ----------------------------------------------------------------------
00481152   2/2  ----------------------------------------------------------------------
00517991   1/1  ----------------------------------------------------------------------
00499572   2/2  ----------------------------------------------------------------------
00513792   2/2  ----------------------------------------------------------------------
00486121   1/2  ----------------------------------------------------------------------
00484801   1/2  ----------------------------------------------------------------------
00499571   1/2  ----------------------------------------------------------------------
00513791   1/2  ----------------------------------------------------------------------