[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for lsal0:ABD99766.1


[Show Plain Result]

## Summary of Sequence Search
   1::102
   1::102  1.2e-35 52.9% 0053072 00530721 1/1   like                                    
   1::102


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MYAIIKTGGKQLKVEAGQTIYVEKLDAKEGDKVTFDKVVFVGGDKTVIGTPFVEGATVEATVEKQGRAKK
00530721   1/1  myAvietggkqykveegdvllvekldaevgdkieldkvllvgsgdlvliGaPlvegakvkaevlehlrgk


                         -         -         *         -         -         -         -:140
query           VVTFKYKPKKHQHTKQGHRQPYTKVVIDAINA--------------------------------------
00530721   1/1  kiivfkfkrrknyrrklghrqeltrlritsil--------------------------------------