[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for lsal0:ABD99837.1


[Show Plain Result]

## Summary of Sequence Search
   1::586
 348::568    1e-58 33.9% 0042280 00422801 1/1   p containing nucleoside triphosphate hy 
 347::586  8.8e-57 31.2% 0048220 00482201 1/1   p containing nucleoside triphosphate hy 
 348::586  8.8e-57 32.5% 0037958 00379581 1/1   p containing nucleoside triphosphate hy 
 332::585  3.7e-55 29.5% 0053059 00530591 1/1   p containing nucleoside triphosphate hy 
 348::582    9e-55 36.1% 0050943 00509431 1/1   p containing nucleoside triphosphate hy 
 348::567  2.9e-54 36.6% 0036790 00367901 1/1   p containing nucleoside triphosphate hy 
 348::583  3.2e-54 35.0% 0049080 00490801 1/1   p containing nucleoside triphosphate hy 
 350::564  3.2e-54 36.8% 0039041 00390411 1/1   p containing nucleoside triphosphate hy 
 348::576  3.5e-54 35.7% 0051025 00510251 1/1   p containing nucleoside triphosphate hy 
 348::582  6.9e-54 32.0% 0037898 00378981 1/1   p containing nucleoside triphosphate hy 
 344::583  7.6e-54 30.5% 0047589 00475891 1/1   p containing nucleoside triphosphate hy 
 348::583  8.8e-54 32.0% 0042070 00420701 1/1   p containing nucleoside triphosphate hy 
 348::587  1.3e-53 30.8% 0048226 00482261 1/1   p containing nucleoside triphosphate hy 
 338::579  2.3e-53 34.6% 0044086 00440861 1/1   p containing nucleoside triphosphate hy 
 344::584    3e-52 29.2% 0050044 00500441 1/1   p containing nucleoside triphosphate hy 
 336::582  4.4e-52 31.2% 0047599 00475991 1/1   p containing nucleoside triphosphate hy 
 345::567  1.1e-51 31.4% 0046697 00466971 1/1   p containing nucleoside triphosphate hy 
 348::583  1.8e-51 32.0% 0042557 00425571 1/1   p containing nucleoside triphosphate hy 
 350::576  2.8e-51 33.0% 0045860 00458601 1/1   p containing nucleoside triphosphate hy 
 348::587  1.4e-50 30.6% 0050274 00502741 1/1   p containing nucleoside triphosphate hy 
 298::572  1.6e-48 33.7% 0037960 00379601 1/1   p containing nucleoside triphosphate hy 
 348::557  4.5e-48 33.3% 0043607 00436071 1/1   p containing nucleoside triphosphate hy 
 349::581  5.4e-48 33.6% 0040410 00404101 1/1   p containing nucleoside triphosphate hy 
 355::567  9.8e-48 32.5% 0046693 00466931 1/1   p containing nucleoside triphosphate hy 
 325::569  1.2e-45 31.9% 0042496 00424961 1/1   p containing nucleoside triphosphate hy 
 344::571  2.4e-45 36.6% 0046869 00468691 1/1   p containing nucleoside triphosphate hy 
 313::551  4.2e-45 28.9% 0043651 00436511 1/1   p containing nucleoside triphosphate hy 
 339::575  2.7e-44 34.7% 0036121 00361211 1/1   p containing nucleoside triphosphate hy 
 355::566  1.5e-43 37.2% 0048545 00485451 1/1   p containing nucleoside triphosphate hy 
 347::577  7.5e-43 38.5% 0046945 00469451 1/1   p containing nucleoside triphosphate hy 
 348::574  6.8e-41 36.8% 0037230 00372301 1/1   p containing nucleoside triphosphate hy 
 348::574  3.2e-39 35.2% 0036748 00367481 1/1   p containing nucleoside triphosphate hy 
 332::569  5.9e-39 32.6% 0042214 00422141 1/1   p containing nucleoside triphosphate hy 
 347::575  5.4e-38 31.4% 0049825 00498251 1/1   p containing nucleoside triphosphate hy 
 370::578  1.6e-37 32.5% 0048593 00485931 1/1   p containing nucleoside triphosphate hy 
 367::579  6.8e-37 28.5% 0046860 00468601 1/1   p containing nucleoside triphosphate hy 
 338::570  7.3e-37 33.0% 0048852 00488521 1/1   p containing nucleoside triphosphate hy 
 365::579  1.3e-36 29.6% 0044893 00448931 1/1   p containing nucleoside triphosphate hy 
 344::576  1.2e-35 30.5% 0043798 00437981 1/1   p containing nucleoside triphosphate hy 
  11::504  1.7e-35 21.2% 0042281 00422811 1/1   ransporter transmembrane region         
 373::560  5.1e-34 36.8% 0042605 00426051 1/1   p containing nucleoside triphosphate hy 
 375::530  2.2e-33 41.8% 0038144 00381441 1/1   p containing nucleoside triphosphate hy 
 364::571  7.8e-33 30.0% 0050337 00503371 1/1   p containing nucleoside triphosphate hy 
 349::568  1.4e-32 34.2% 0049611 00496111 1/1   p containing nucleoside triphosphate hy 
 338::569  1.8e-32 30.6% 0050061 00500611 1/1   p containing nucleoside triphosphate hy 
 341::569    3e-32 30.5% 0049537 00495371 1/1   p containing nucleoside triphosphate hy 
  12::347    1e-31 19.9% 0053060 00530601 1/1   ransporter transmembrane region         
 370::542  9.8e-31 35.7% 0045157 00451571 1/1   p containing nucleoside triphosphate hy 
 347::570  1.4e-30 32.0% 0037163 00371631 1/1   p containing nucleoside triphosphate hy 
 306::564  5.6e-30 29.3% 0046479 00464791 1/1   p containing nucleoside triphosphate hy 
 362::567    9e-30 35.7% 0053253 00532531 1/1   arboxykinase-like                       
 342::583  1.8e-29 24.1% 0036850 00368501 1/1   p containing nucleoside triphosphate hy 
 369::516  9.2e-28 37.0% 0048047 00480471 1/1   p containing nucleoside triphosphate hy 
 364::581  1.1e-27 30.4% 0047537 00475371 1/1   p containing nucleoside triphosphate hy 
 373::569  1.6e-27 36.2% 0045731 00457311 1/1   p containing nucleoside triphosphate hy 
 346::463  2.5e-27 34.5% 0038720 00387201 1/1   p containing nucleoside triphosphate hy 
 362::533  7.6e-27 37.4% 0047552 00475521 1/1   arboxykinase-like                       
 343::569  4.9e-26 28.1% 0049503 00495031 1/1   p containing nucleoside triphosphate hy 
 359::569  1.2e-25 33.3% 0046276 00462761 1/1   p containing nucleoside triphosphate hy 
 360::548  2.9e-25 36.1% 0047841 00478411 1/1   arboxykinase-like                       
 373::579  6.9e-25 34.2% 0047538 00475381 1/1   p containing nucleoside triphosphate hy 
 373::564  7.2e-25 30.4% 0041412 00414121 1/1   p containing nucleoside triphosphate hy 
 343::575  3.4e-24 32.0% 0043794 00437941 1/1   p containing nucleoside triphosphate hy 
 350::584  5.4e-24 29.3% 0050374 00503741 1/1   p containing nucleoside triphosphate hy 
 360::544  1.3e-23 34.8% 0047844 00478441 1/1   arboxykinase-like                       
 376::568    3e-23 29.9% 0051289 00512891 1/1   p containing nucleoside triphosphate hy 
 374::537  4.7e-23 33.1% 0051553 00515531 1/1   p containing nucleoside triphosphate hy 
 323::548  2.1e-21 27.9% 0036857 00368571 1/1   p containing nucleoside triphosphate hy 
 374::534  2.7e-21 34.0% 0051551 00515511 1/1   p containing nucleoside triphosphate hy 
 351::583  3.8e-21 25.9% 0048957 00489571 1/1   p containing nucleoside triphosphate hy 
 350::542    7e-21 37.9% 0035641 00356411 1/1   p containing nucleoside triphosphate hy 
 350::578  8.5e-21 27.1% 0037996 00379961 1/1   p containing nucleoside triphosphate hy 
 373::555  1.5e-20 27.2% 0047797 00477971 1/1   p containing nucleoside triphosphate hy 
 375::541  2.9e-20 29.0% 0048410 00484101 1/1   p containing nucleoside triphosphate hy 
 343::583  4.7e-20 23.8% 0037926 00379261 1/1   p containing nucleoside triphosphate hy 
 375::571  1.4e-19 25.6% 0040588 00405881 1/1   p containing nucleoside triphosphate hy 
 353::541    3e-19 23.2% 0047701 00477011 1/1   p containing nucleoside triphosphate hy 
 355::548  4.4e-19 30.5% 0043440 00434401 1/1   p containing nucleoside triphosphate hy 
 367::561    8e-19 29.7% 0049073 00490731 1/1   p containing nucleoside triphosphate hy 
 342::557  9.5e-19 27.5% 0040419 00404191 1/1   p containing nucleoside triphosphate hy 
 377::579    1e-18 31.2% 0048702 00487021 1/1   p containing nucleoside triphosphate hy 
 375::556  3.5e-18 33.1% 0053350 00533501 1/1   p containing nucleoside triphosphate hy 
 285::477  4.4e-18 25.9% 0049577 00495771 1/1   p containing nucleoside triphosphate hy 
 375::563  4.7e-18 36.4% 0049919 00499191 1/1   p containing nucleoside triphosphate hy 
 369::542  1.8e-17 36.7% 0043218 00432181 1/1   p containing nucleoside triphosphate hy 
 374::576  2.1e-17 28.4% 0049343 00493431 1/1   p containing nucleoside triphosphate hy 
 376::579  1.1e-16 22.2% 0051376 00513761 1/1   p containing nucleoside triphosphate hy 
 359::562  2.3e-16 31.6% 0039270 00392701 1/1   p containing nucleoside triphosphate hy 
 319::568  5.5e-16 23.2% 0051056 00510561 1/1   p containing nucleoside triphosphate hy 
 373::582  6.4e-16 32.4% 0046441 00464411 1/1   p containing nucleoside triphosphate hy 
 340::542  1.8e-15 29.1% 0044438 00444381 1/1   p containing nucleoside triphosphate hy 
 375::553  3.3e-15 35.9% 0049657 00496571 1/1   p containing nucleoside triphosphate hy 
 374::583  5.1e-15 27.5% 0053247 00532471 1/1   p containing nucleoside triphosphate hy 
  62::562  5.2e-15 27.4% 0040678 00406781 1/1   p containing nucleoside triphosphate hy 
 349::559    3e-14 27.2% 0043986 00439861 1/1   p containing nucleoside triphosphate hy 
 362::549  5.7e-14 27.1% 0047073 00470731 1/1   p containing nucleoside triphosphate hy 
 375::564  9.7e-14 25.1% 0049881 00498811 1/1   p containing nucleoside triphosphate hy 
 335::544  3.1e-13 24.8% 0039472 00394721 1/1   p containing nucleoside triphosphate hy 
 319::586  1.5e-12 21.6% 0049853 00498531 1/1   p containing nucleoside triphosphate hy 
 362::576  2.6e-12 27.2% 0051325 00513251 1/1   p containing nucleoside triphosphate hy 
 374::561  3.2e-12 23.9% 0048963 00489631 1/1   p containing nucleoside triphosphate hy 
 350::557  4.5e-12 30.0% 0042094 00420941 1/1   p containing nucleoside triphosphate hy 
 376::564  9.4e-12 21.7% 0048044 00480441 1/1   p containing nucleoside triphosphate hy 
 343::588  1.1e-11 24.0% 0046895 00468951 1/1   p containing nucleoside triphosphate hy 
 368::559  1.3e-11 27.5% 0051769 00517691 1/1   p containing nucleoside triphosphate hy 
 349::544  8.2e-11 26.7% 0038674 00386741 1/1   p containing nucleoside triphosphate hy 
 375::542  2.1e-10 25.0% 0047607 00476071 1/1   p containing nucleoside triphosphate hy 
 375::572  2.5e-10 21.7% 0048272 00482721 1/1   p containing nucleoside triphosphate hy 
 345::551  3.3e-10 23.7% 0052726 00527261 1/1   p containing nucleoside triphosphate hy 
 342::544  4.5e-10 25.4% 0043792 00437921 1/1   p containing nucleoside triphosphate hy 
 368::529  5.4e-10 28.7% 0050867 00508671 1/1   p containing nucleoside triphosphate hy 
 353::561  8.1e-10 23.4% 0036729 00367291 1/1   p containing nucleoside triphosphate hy 
 368::529  8.1e-10 31.7% 0040984 00409841 1/1   p containing nucleoside triphosphate hy 
 367::550  1.2e-09 21.9% 0048025 00480251 1/1   p containing nucleoside triphosphate hy 
 363::547  1.4e-09 24.6% 0041053 00410531 1/1   p containing nucleoside triphosphate hy 
 375::585  2.1e-09 29.1% 0047808 00478081 1/1   p containing nucleoside triphosphate hy 
 359::409  2.9e-09 36.0% 0041032 00410321 1/1   p containing nucleoside triphosphate hy 
 360::544    3e-09 24.4% 0043790 00437901 1/1   p containing nucleoside triphosphate hy 
 345::561  4.4e-09 24.2% 0052155 00521551 1/1   p containing nucleoside triphosphate hy 
 345::408  4.7e-09 32.8% 0047127 00471271 1/1   p containing nucleoside triphosphate hy 
 369::583  1.1e-08 29.8% 0053315 00533151 1/1   p containing nucleoside triphosphate hy 
 371::512  5.7e-08 29.7% 0040121 00401211 1/1   p containing nucleoside triphosphate hy 
 348::544  1.4e-07 22.5% 0047394 00473941 1/1   p containing nucleoside triphosphate hy 
 374::514  1.4e-07 30.6% 0046162 00461621 1/1   p containing nucleoside triphosphate hy 
 334::575  2.2e-07 21.7% 0040237 00402371 1/1   p containing nucleoside triphosphate hy 
 369::579  2.5e-07 26.0% 0049933 00499331 1/1   p containing nucleoside triphosphate hy 
 373::588  3.6e-07 26.9% 0048706 00487061 1/1   p containing nucleoside triphosphate hy 
 375::512  4.8e-07 28.6% 0051535 00515351 1/1   p containing nucleoside triphosphate hy 
 374::545  6.4e-07 25.9% 0040315 00403151 1/1   p containing nucleoside triphosphate hy 
 374::544  6.5e-07 32.4% 0051958 00519581 1/1   p containing nucleoside triphosphate hy 
 375::511  6.6e-07 28.0% 0049606 00496061 1/1   p containing nucleoside triphosphate hy 
 360::416    7e-07 32.7% 0037862 00378621 1/1   p containing nucleoside triphosphate hy 
 371::556  1.5e-06 27.9% 0047839 00478391 1/1   p containing nucleoside triphosphate hy 
 371::576  2.8e-06 21.8% 0047291 00472911 1/1   p containing nucleoside triphosphate hy 
 376::579  3.3e-06 27.6% 0046916 00469161 1/1   p containing nucleoside triphosphate hy 
 377::560  4.6e-06 23.4% 0050989 00509891 1/1   p containing nucleoside triphosphate hy 
 351::508  7.6e-06 26.7% 0047023 00470231 1/1   p containing nucleoside triphosphate hy 
 360::416  8.8e-06 29.1% 0038732 00387321 1/1   p containing nucleoside triphosphate hy 
 343::555  9.7e-06 23.1% 0041830 00418301 1/1   p containing nucleoside triphosphate hy 
 375::408  1.1e-05 36.4% 0052346 00523461 1/1   p containing nucleoside triphosphate hy 
 214::555  1.5e-05 20.6% 0049757 00497571 1/1   p containing nucleoside triphosphate hy 
 353::555  1.5e-05 20.1% 0041617 00416171 1/1   p containing nucleoside triphosphate hy 
 369::563  2.1e-05 25.6% 0051138 00511381 1/1   p containing nucleoside triphosphate hy 
 339::545  2.3e-05 20.5% 0048266 00482661 1/1   p containing nucleoside triphosphate hy 
 370::583  2.4e-05 22.5% 0048939 00489391 1/1   p containing nucleoside triphosphate hy 
 371::416    3e-05 31.7% 0044482 00444821 1/1   p containing nucleoside triphosphate hy 
 285::409    4e-05 27.0% 0049759 00497591 1/1   p containing nucleoside triphosphate hy 
 377::408  6.9e-05 41.9% 0052691 00526911 1/1   p containing nucleoside triphosphate hy 
 371::416  7.8e-05 35.7% 0035786 00357861 1/1   p containing nucleoside triphosphate hy 
 374::408  9.6e-05 34.3% 0044740 00447401 1/1   p containing nucleoside triphosphate hy 
 375::511   0.0001 26.9% 0045785 00457851 1/1   p containing nucleoside triphosphate hy 
 323::555  0.00012 17.6% 0043012 00430121 1/1   p containing nucleoside triphosphate hy 
 361::409  0.00014 29.2% 0051582 00515821 1/1   p containing nucleoside triphosphate hy 
 373::409  0.00014 40.5% 0051793 00517931 1/1   p containing nucleoside triphosphate hy 
 374::431  0.00014 31.6% 0037884 00378841 1/1   p containing nucleoside triphosphate hy 
 371::431  0.00015 25.0% 0046551 00465511 1/1   p containing nucleoside triphosphate hy 
 374::408  0.00016 25.7% 0051831 00518311 1/1   p containing nucleoside triphosphate hy 
 366::409  0.00017 35.0% 0051448 00514481 1/1   p containing nucleoside triphosphate hy 
 371::525  0.00017 20.0% 0042008 00420081 1/1   p containing nucleoside triphosphate hy 
 376::413  0.00019 31.6% 0052832 00528321 1/1   p containing nucleoside triphosphate hy 
 376::409  0.00021 39.4% 0040747 00407471 1/1   p containing nucleoside triphosphate hy 
 371::532  0.00022 23.8% 0051604 00516041 1/1   p containing nucleoside triphosphate hy 
 370::408  0.00027 33.3% 0044990 00449901 1/1   p containing nucleoside triphosphate hy 
 373::408  0.00028 33.3% 0051704 00517041 1/1   p containing nucleoside triphosphate hy 
 374::416  0.00028 31.7% 0051952 00519521 1/1   p containing nucleoside triphosphate hy 
 357::406  0.00029 26.0% 0051784 00517841 1/1   p containing nucleoside triphosphate hy 
 353::406  0.00031 29.6% 0042471 00424711 1/1   p containing nucleoside triphosphate hy 
 363::409  0.00034 32.6% 0052859 00528591 1/1   p containing nucleoside triphosphate hy 
 374::409  0.00034 37.1% 0040239 00402391 1/1   p containing nucleoside triphosphate hy 
 362::409  0.00035 27.1% 0048819 00488191 1/1   p containing nucleoside triphosphate hy 
 369::416  0.00043 27.1% 0051832 00518321 1/1   p containing nucleoside triphosphate hy 
 373::409   0.0005 38.2% 0048426 00484261 1/1   p containing nucleoside triphosphate hy 
 373::416  0.00051 26.2% 0049404 00494041 1/1   p containing nucleoside triphosphate hy 
 376::406  0.00051 35.5% 0048180 00481801 1/1   p containing nucleoside triphosphate hy 
 374::416  0.00053 25.6% 0048113 00481131 1/1   p containing nucleoside triphosphate hy 
 367::431  0.00054 27.7% 0037248 00372481 1/1   p containing nucleoside triphosphate hy 
 375::408  0.00061 32.4% 0052098 00520981 1/1   p containing nucleoside triphosphate hy 
 371::408  0.00071 26.3% 0048154 00481541 1/1   p containing nucleoside triphosphate hy 
 373::408  0.00071 27.8% 0053196 00531961 1/1   p containing nucleoside triphosphate hy 
 372::408  0.00074 35.1% 0044233 00442331 1/1   p containing nucleoside triphosphate hy 
 373::409  0.00082 37.8% 0039672 00396721 1/1   p containing nucleoside triphosphate hy 
 376::408  0.00092 36.4% 0049868 00498681 1/1   p containing nucleoside triphosphate hy 
   1::586


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MFKKIPLLQELKKDTWVKPFLKKYKKTLVLAIFLGILTFFCAGALMFNSGYLISRSATRPENILLVYVPI
00422801   1/1  ----------------------------------------------------------------------
00482201   1/1  ----------------------------------------------------------------------
00379581   1/1  ----------------------------------------------------------------------
00530591   1/1  ----------------------------------------------------------------------
00509431   1/1  ----------------------------------------------------------------------
00367901   1/1  ----------------------------------------------------------------------
00490801   1/1  ----------------------------------------------------------------------
00390411   1/1  ----------------------------------------------------------------------
00510251   1/1  ----------------------------------------------------------------------
00378981   1/1  ----------------------------------------------------------------------
00475891   1/1  ----------------------------------------------------------------------
00420701   1/1  ----------------------------------------------------------------------
00482261   1/1  ----------------------------------------------------------------------
00440861   1/1  ----------------------------------------------------------------------
00500441   1/1  ----------------------------------------------------------------------
00475991   1/1  ----------------------------------------------------------------------
00466971   1/1  ----------------------------------------------------------------------
00425571   1/1  ----------------------------------------------------------------------
00458601   1/1  ----------------------------------------------------------------------
00502741   1/1  ----------------------------------------------------------------------
00379601   1/1  ----------------------------------------------------------------------
00436071   1/1  ----------------------------------------------------------------------
00404101   1/1  ----------------------------------------------------------------------
00466931   1/1  ----------------------------------------------------------------------
00424961   1/1  ----------------------------------------------------------------------
00468691   1/1  ----------------------------------------------------------------------
00436511   1/1  ----------------------------------------------------------------------
00361211   1/1  ----------------------------------------------------------------------
00485451   1/1  ----------------------------------------------------------------------
00469451   1/1  ----------------------------------------------------------------------
00372301   1/1  ----------------------------------------------------------------------
00367481   1/1  ----------------------------------------------------------------------
00422141   1/1  ----------------------------------------------------------------------
00498251   1/1  ----------------------------------------------------------------------
00485931   1/1  ----------------------------------------------------------------------
00468601   1/1  ----------------------------------------------------------------------
00488521   1/1  ----------------------------------------------------------------------
00448931   1/1  ----------------------------------------------------------------------
00437981   1/1  ----------------------------------------------------------------------
00422811   1/1  ----------ekeekrllrylkpykkllllalllallaallslllplllgrlidallpgg.dlsllllla
00426051   1/1  ----------------------------------------------------------------------
00381441   1/1  ----------------------------------------------------------------------
00503371   1/1  ----------------------------------------------------------------------
00496111   1/1  ----------------------------------------------------------------------
00500611   1/1  ----------------------------------------------------------------------
00495371   1/1  ----------------------------------------------------------------------
00530601   1/1  -----------ep.kRllrylkpykkllllalllsllaallslllplllgqlidalllgg.dlsdpllll
00451571   1/1  ----------------------------------------------------------------------
00371631   1/1  ----------------------------------------------------------------------
00464791   1/1  ----------------------------------------------------------------------
00532531   1/1  ----------------------------------------------------------------------
00368501   1/1  ----------------------------------------------------------------------
00480471   1/1  ----------------------------------------------------------------------
00475371   1/1  ----------------------------------------------------------------------
00457311   1/1  ----------------------------------------------------------------------
00387201   1/1  ----------------------------------------------------------------------
00475521   1/1  ----------------------------------------------------------------------
00495031   1/1  ----------------------------------------------------------------------
00462761   1/1  ----------------------------------------------------------------------
00478411   1/1  ----------------------------------------------------------------------
00475381   1/1  ----------------------------------------------------------------------
00414121   1/1  ----------------------------------------------------------------------
00437941   1/1  ----------------------------------------------------------------------
00503741   1/1  ----------------------------------------------------------------------
00478441   1/1  ----------------------------------------------------------------------
00512891   1/1  ----------------------------------------------------------------------
00515531   1/1  ----------------------------------------------------------------------
00368571   1/1  ----------------------------------------------------------------------
00515511   1/1  ----------------------------------------------------------------------
00489571   1/1  ----------------------------------------------------------------------
00356411   1/1  ----------------------------------------------------------------------
00379961   1/1  ----------------------------------------------------------------------
00477971   1/1  ----------------------------------------------------------------------
00484101   1/1  ----------------------------------------------------------------------
00379261   1/1  ----------------------------------------------------------------------
00405881   1/1  ----------------------------------------------------------------------
00477011   1/1  ----------------------------------------------------------------------
00434401   1/1  ----------------------------------------------------------------------
00490731   1/1  ----------------------------------------------------------------------
00404191   1/1  ----------------------------------------------------------------------
00487021   1/1  ----------------------------------------------------------------------
00533501   1/1  ----------------------------------------------------------------------
00495771   1/1  ----------------------------------------------------------------------
00499191   1/1  ----------------------------------------------------------------------
00432181   1/1  ----------------------------------------------------------------------
00493431   1/1  ----------------------------------------------------------------------
00513761   1/1  ----------------------------------------------------------------------
00392701   1/1  ----------------------------------------------------------------------
00510561   1/1  ----------------------------------------------------------------------
00464411   1/1  ----------------------------------------------------------------------
00444381   1/1  ----------------------------------------------------------------------
00496571   1/1  ----------------------------------------------------------------------
00532471   1/1  ----------------------------------------------------------------------
00406781   1/1  -------------------------------------------------------------plveklrpv
00439861   1/1  ----------------------------------------------------------------------
00470731   1/1  ----------------------------------------------------------------------
00498811   1/1  ----------------------------------------------------------------------
00394721   1/1  ----------------------------------------------------------------------
00498531   1/1  ----------------------------------------------------------------------
00513251   1/1  ----------------------------------------------------------------------
00489631   1/1  ----------------------------------------------------------------------
00420941   1/1  ----------------------------------------------------------------------
00480441   1/1  ----------------------------------------------------------------------
00468951   1/1  ----------------------------------------------------------------------
00517691   1/1  ----------------------------------------------------------------------
00386741   1/1  ----------------------------------------------------------------------
00476071   1/1  ----------------------------------------------------------------------
00482721   1/1  ----------------------------------------------------------------------
00527261   1/1  ----------------------------------------------------------------------
00437921   1/1  ----------------------------------------------------------------------
00508671   1/1  ----------------------------------------------------------------------
00367291   1/1  ----------------------------------------------------------------------
00409841   1/1  ----------------------------------------------------------------------
00480251   1/1  ----------------------------------------------------------------------
00410531   1/1  ----------------------------------------------------------------------
00478081   1/1  ----------------------------------------------------------------------
00410321   1/1  ----------------------------------------------------------------------
00437901   1/1  ----------------------------------------------------------------------
00521551   1/1  ----------------------------------------------------------------------
00471271   1/1  ----------------------------------------------------------------------
00533151   1/1  ----------------------------------------------------------------------
00401211   1/1  ----------------------------------------------------------------------
00473941   1/1  ----------------------------------------------------------------------
00461621   1/1  ----------------------------------------------------------------------
00402371   1/1  ----------------------------------------------------------------------
00499331   1/1  ----------------------------------------------------------------------
00487061   1/1  ----------------------------------------------------------------------
00515351   1/1  ----------------------------------------------------------------------
00403151   1/1  ----------------------------------------------------------------------
00519581   1/1  ----------------------------------------------------------------------
00496061   1/1  ----------------------------------------------------------------------
00378621   1/1  ----------------------------------------------------------------------
00478391   1/1  ----------------------------------------------------------------------
00472911   1/1  ----------------------------------------------------------------------
00469161   1/1  ----------------------------------------------------------------------
00509891   1/1  ----------------------------------------------------------------------
00470231   1/1  ----------------------------------------------------------------------
00387321   1/1  ----------------------------------------------------------------------
00418301   1/1  ----------------------------------------------------------------------
00523461   1/1  ----------------------------------------------------------------------
00497571   1/1  ----------------------------------------------------------------------
00416171   1/1  ----------------------------------------------------------------------
00511381   1/1  ----------------------------------------------------------------------
00482661   1/1  ----------------------------------------------------------------------
00489391   1/1  ----------------------------------------------------------------------
00444821   1/1  ----------------------------------------------------------------------
00497591   1/1  ----------------------------------------------------------------------
00526911   1/1  ----------------------------------------------------------------------
00357861   1/1  ----------------------------------------------------------------------
00447401   1/1  ----------------------------------------------------------------------
00457851   1/1  ----------------------------------------------------------------------
00430121   1/1  ----------------------------------------------------------------------
00515821   1/1  ----------------------------------------------------------------------
00517931   1/1  ----------------------------------------------------------------------
00378841   1/1  ----------------------------------------------------------------------
00465511   1/1  ----------------------------------------------------------------------
00518311   1/1  ----------------------------------------------------------------------
00514481   1/1  ----------------------------------------------------------------------
00420081   1/1  ----------------------------------------------------------------------
00528321   1/1  ----------------------------------------------------------------------
00407471   1/1  ----------------------------------------------------------------------
00516041   1/1  ----------------------------------------------------------------------
00449901   1/1  ----------------------------------------------------------------------
00517041   1/1  ----------------------------------------------------------------------
00519521   1/1  ----------------------------------------------------------------------
00517841   1/1  ----------------------------------------------------------------------
00424711   1/1  ----------------------------------------------------------------------
00528591   1/1  ----------------------------------------------------------------------
00402391   1/1  ----------------------------------------------------------------------
00488191   1/1  ----------------------------------------------------------------------
00518321   1/1  ----------------------------------------------------------------------
00484261   1/1  ----------------------------------------------------------------------
00494041   1/1  ----------------------------------------------------------------------
00481801   1/1  ----------------------------------------------------------------------
00481131   1/1  ----------------------------------------------------------------------
00372481   1/1  ----------------------------------------------------------------------
00520981   1/1  ----------------------------------------------------------------------
00481541   1/1  ----------------------------------------------------------------------
00531961   1/1  ----------------------------------------------------------------------
00442331   1/1  ----------------------------------------------------------------------
00396721   1/1  ----------------------------------------------------------------------
00498681   1/1  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           VLTRAFGVGRPVFHYLERLTSHNWVFKMTSDLRVKLYKALEKDAVFFKSKYQLGDVLGLLSEDINHIQNL
00422801   1/1  ----------------------------------------------------------------------
00482201   1/1  ----------------------------------------------------------------------
00379581   1/1  ----------------------------------------------------------------------
00530591   1/1  ----------------------------------------------------------------------
00509431   1/1  ----------------------------------------------------------------------
00367901   1/1  ----------------------------------------------------------------------
00490801   1/1  ----------------------------------------------------------------------
00390411   1/1  ----------------------------------------------------------------------
00510251   1/1  ----------------------------------------------------------------------
00378981   1/1  ----------------------------------------------------------------------
00475891   1/1  ----------------------------------------------------------------------
00420701   1/1  ----------------------------------------------------------------------
00482261   1/1  ----------------------------------------------------------------------
00440861   1/1  ----------------------------------------------------------------------
00500441   1/1  ----------------------------------------------------------------------
00475991   1/1  ----------------------------------------------------------------------
00466971   1/1  ----------------------------------------------------------------------
00425571   1/1  ----------------------------------------------------------------------
00458601   1/1  ----------------------------------------------------------------------
00502741   1/1  ----------------------------------------------------------------------
00379601   1/1  ----------------------------------------------------------------------
00436071   1/1  ----------------------------------------------------------------------
00404101   1/1  ----------------------------------------------------------------------
00466931   1/1  ----------------------------------------------------------------------
00424961   1/1  ----------------------------------------------------------------------
00468691   1/1  ----------------------------------------------------------------------
00436511   1/1  ----------------------------------------------------------------------
00361211   1/1  ----------------------------------------------------------------------
00485451   1/1  ----------------------------------------------------------------------
00469451   1/1  ----------------------------------------------------------------------
00372301   1/1  ----------------------------------------------------------------------
00367481   1/1  ----------------------------------------------------------------------
00422141   1/1  ----------------------------------------------------------------------
00498251   1/1  ----------------------------------------------------------------------
00485931   1/1  ----------------------------------------------------------------------
00468601   1/1  ----------------------------------------------------------------------
00488521   1/1  ----------------------------------------------------------------------
00448931   1/1  ----------------------------------------------------------------------
00437981   1/1  ----------------------------------------------------------------------
00422811   1/1  llllllallrallsylrsyllarlgqrllarlrsrlfrkllrlplsffdktstGdllsrltnDveaidel
00426051   1/1  ----------------------------------------------------------------------
00381441   1/1  ----------------------------------------------------------------------
00503371   1/1  ----------------------------------------------------------------------
00496111   1/1  ----------------------------------------------------------------------
00500611   1/1  ----------------------------------------------------------------------
00495371   1/1  ----------------------------------------------------------------------
00530601   1/1  stlllllllllllallrallsylrsyllarlgqrlsarlrlrlfrkllrlplsffdktstGdllsrltnD
00451571   1/1  ----------------------------------------------------------------------
00371631   1/1  ----------------------------------------------------------------------
00464791   1/1  ----------------------------------------------------------------------
00532531   1/1  ----------------------------------------------------------------------
00368501   1/1  ----------------------------------------------------------------------
00480471   1/1  ----------------------------------------------------------------------
00475371   1/1  ----------------------------------------------------------------------
00457311   1/1  ----------------------------------------------------------------------
00387201   1/1  ----------------------------------------------------------------------
00475521   1/1  ----------------------------------------------------------------------
00495031   1/1  ----------------------------------------------------------------------
00462761   1/1  ----------------------------------------------------------------------
00478411   1/1  ----------------------------------------------------------------------
00475381   1/1  ----------------------------------------------------------------------
00414121   1/1  ----------------------------------------------------------------------
00437941   1/1  ----------------------------------------------------------------------
00503741   1/1  ----------------------------------------------------------------------
00478441   1/1  ----------------------------------------------------------------------
00512891   1/1  ----------------------------------------------------------------------
00515531   1/1  ----------------------------------------------------------------------
00368571   1/1  ----------------------------------------------------------------------
00515511   1/1  ----------------------------------------------------------------------
00489571   1/1  ----------------------------------------------------------------------
00356411   1/1  ----------------------------------------------------------------------
00379961   1/1  ----------------------------------------------------------------------
00477971   1/1  ----------------------------------------------------------------------
00484101   1/1  ----------------------------------------------------------------------
00379261   1/1  ----------------------------------------------------------------------
00405881   1/1  ----------------------------------------------------------------------
00477011   1/1  ----------------------------------------------------------------------
00434401   1/1  ----------------------------------------------------------------------
00490731   1/1  ----------------------------------------------------------------------
00404191   1/1  ----------------------------------------------------------------------
00487021   1/1  ----------------------------------------------------------------------
00533501   1/1  ----------------------------------------------------------------------
00495771   1/1  ----------------------------------------------------------------------
00499191   1/1  ----------------------------------------------------------------------
00432181   1/1  ----------------------------------------------------------------------
00493431   1/1  ----------------------------------------------------------------------
00513761   1/1  ----------------------------------------------------------------------
00392701   1/1  ----------------------------------------------------------------------
00510561   1/1  ----------------------------------------------------------------------
00464411   1/1  ----------------------------------------------------------------------
00444381   1/1  ----------------------------------------------------------------------
00496571   1/1  ----------------------------------------------------------------------
00532471   1/1  ----------------------------------------------------------------------
00406781   1/1  llddvigqeeakeallealagl................................................
00439861   1/1  ----------------------------------------------------------------------
00470731   1/1  ----------------------------------------------------------------------
00498811   1/1  ----------------------------------------------------------------------
00394721   1/1  ----------------------------------------------------------------------
00498531   1/1  ----------------------------------------------------------------------
00513251   1/1  ----------------------------------------------------------------------
00489631   1/1  ----------------------------------------------------------------------
00420941   1/1  ----------------------------------------------------------------------
00480441   1/1  ----------------------------------------------------------------------
00468951   1/1  ----------------------------------------------------------------------
00517691   1/1  ----------------------------------------------------------------------
00386741   1/1  ----------------------------------------------------------------------
00476071   1/1  ----------------------------------------------------------------------
00482721   1/1  ----------------------------------------------------------------------
00527261   1/1  ----------------------------------------------------------------------
00437921   1/1  ----------------------------------------------------------------------
00508671   1/1  ----------------------------------------------------------------------
00367291   1/1  ----------------------------------------------------------------------
00409841   1/1  ----------------------------------------------------------------------
00480251   1/1  ----------------------------------------------------------------------
00410531   1/1  ----------------------------------------------------------------------
00478081   1/1  ----------------------------------------------------------------------
00410321   1/1  ----------------------------------------------------------------------
00437901   1/1  ----------------------------------------------------------------------
00521551   1/1  ----------------------------------------------------------------------
00471271   1/1  ----------------------------------------------------------------------
00533151   1/1  ----------------------------------------------------------------------
00401211   1/1  ----------------------------------------------------------------------
00473941   1/1  ----------------------------------------------------------------------
00461621   1/1  ----------------------------------------------------------------------
00402371   1/1  ----------------------------------------------------------------------
00499331   1/1  ----------------------------------------------------------------------
00487061   1/1  ----------------------------------------------------------------------
00515351   1/1  ----------------------------------------------------------------------
00403151   1/1  ----------------------------------------------------------------------
00519581   1/1  ----------------------------------------------------------------------
00496061   1/1  ----------------------------------------------------------------------
00378621   1/1  ----------------------------------------------------------------------
00478391   1/1  ----------------------------------------------------------------------
00472911   1/1  ----------------------------------------------------------------------
00469161   1/1  ----------------------------------------------------------------------
00509891   1/1  ----------------------------------------------------------------------
00470231   1/1  ----------------------------------------------------------------------
00387321   1/1  ----------------------------------------------------------------------
00418301   1/1  ----------------------------------------------------------------------
00523461   1/1  ----------------------------------------------------------------------
00497571   1/1  ----------------------------------------------------------------------
00416171   1/1  ----------------------------------------------------------------------
00511381   1/1  ----------------------------------------------------------------------
00482661   1/1  ----------------------------------------------------------------------
00489391   1/1  ----------------------------------------------------------------------
00444821   1/1  ----------------------------------------------------------------------
00497591   1/1  ----------------------------------------------------------------------
00526911   1/1  ----------------------------------------------------------------------
00357861   1/1  ----------------------------------------------------------------------
00447401   1/1  ----------------------------------------------------------------------
00457851   1/1  ----------------------------------------------------------------------
00430121   1/1  ----------------------------------------------------------------------
00515821   1/1  ----------------------------------------------------------------------
00517931   1/1  ----------------------------------------------------------------------
00378841   1/1  ----------------------------------------------------------------------
00465511   1/1  ----------------------------------------------------------------------
00518311   1/1  ----------------------------------------------------------------------
00514481   1/1  ----------------------------------------------------------------------
00420081   1/1  ----------------------------------------------------------------------
00528321   1/1  ----------------------------------------------------------------------
00407471   1/1  ----------------------------------------------------------------------
00516041   1/1  ----------------------------------------------------------------------
00449901   1/1  ----------------------------------------------------------------------
00517041   1/1  ----------------------------------------------------------------------
00519521   1/1  ----------------------------------------------------------------------
00517841   1/1  ----------------------------------------------------------------------
00424711   1/1  ----------------------------------------------------------------------
00528591   1/1  ----------------------------------------------------------------------
00402391   1/1  ----------------------------------------------------------------------
00488191   1/1  ----------------------------------------------------------------------
00518321   1/1  ----------------------------------------------------------------------
00484261   1/1  ----------------------------------------------------------------------
00494041   1/1  ----------------------------------------------------------------------
00481801   1/1  ----------------------------------------------------------------------
00481131   1/1  ----------------------------------------------------------------------
00372481   1/1  ----------------------------------------------------------------------
00520981   1/1  ----------------------------------------------------------------------
00481541   1/1  ----------------------------------------------------------------------
00531961   1/1  ----------------------------------------------------------------------
00442331   1/1  ----------------------------------------------------------------------
00396721   1/1  ----------------------------------------------------------------------
00498681   1/1  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           YLRTIFPTFVAWGLYVFIVIGVGIFSIWMGLLMLLMIGIMLVAFPIWSVIVNGARQEYEKKIKNELYLDL
00422801   1/1  ----------------------------------------------------------------------
00482201   1/1  ----------------------------------------------------------------------
00379581   1/1  ----------------------------------------------------------------------
00530591   1/1  ----------------------------------------------------------------------
00509431   1/1  ----------------------------------------------------------------------
00367901   1/1  ----------------------------------------------------------------------
00490801   1/1  ----------------------------------------------------------------------
00390411   1/1  ----------------------------------------------------------------------
00510251   1/1  ----------------------------------------------------------------------
00378981   1/1  ----------------------------------------------------------------------
00475891   1/1  ----------------------------------------------------------------------
00420701   1/1  ----------------------------------------------------------------------
00482261   1/1  ----------------------------------------------------------------------
00440861   1/1  ----------------------------------------------------------------------
00500441   1/1  ----------------------------------------------------------------------
00475991   1/1  ----------------------------------------------------------------------
00466971   1/1  ----------------------------------------------------------------------
00425571   1/1  ----------------------------------------------------------------------
00458601   1/1  ----------------------------------------------------------------------
00502741   1/1  ----------------------------------------------------------------------
00379601   1/1  ----------------------------------------------------------------------
00436071   1/1  ----------------------------------------------------------------------
00404101   1/1  ----------------------------------------------------------------------
00466931   1/1  ----------------------------------------------------------------------
00424961   1/1  ----------------------------------------------------------------------
00468691   1/1  ----------------------------------------------------------------------
00436511   1/1  ----------------------------------------------------------------------
00361211   1/1  ----------------------------------------------------------------------
00485451   1/1  ----------------------------------------------------------------------
00469451   1/1  ----------------------------------------------------------------------
00372301   1/1  ----------------------------------------------------------------------
00367481   1/1  ----------------------------------------------------------------------
00422141   1/1  ----------------------------------------------------------------------
00498251   1/1  ----------------------------------------------------------------------
00485931   1/1  ----------------------------------------------------------------------
00468601   1/1  ----------------------------------------------------------------------
00488521   1/1  ----------------------------------------------------------------------
00448931   1/1  ----------------------------------------------------------------------
00437981   1/1  ----------------------------------------------------------------------
00422811   1/1  lssllltllralltllgalivlfylswrlalvllll.lpllllltllfgkrlrklsrlvqealselnsvl
00426051   1/1  ----------------------------------------------------------------------
00381441   1/1  ----------------------------------------------------------------------
00503371   1/1  ----------------------------------------------------------------------
00496111   1/1  ----------------------------------------------------------------------
00500611   1/1  ----------------------------------------------------------------------
00495371   1/1  ----------------------------------------------------------------------
00530601   1/1  veaidellssllltlllalltligalivlfliswklalvlllllpl.lllltllfgkrlrklsrlaqeal
00451571   1/1  ----------------------------------------------------------------------
00371631   1/1  ----------------------------------------------------------------------
00464791   1/1  ----------------------------------------------------------------------
00532531   1/1  ----------------------------------------------------------------------
00368501   1/1  ----------------------------------------------------------------------
00480471   1/1  ----------------------------------------------------------------------
00475371   1/1  ----------------------------------------------------------------------
00457311   1/1  ----------------------------------------------------------------------
00387201   1/1  ----------------------------------------------------------------------
00475521   1/1  ----------------------------------------------------------------------
00495031   1/1  ----------------------------------------------------------------------
00462761   1/1  ----------------------------------------------------------------------
00478411   1/1  ----------------------------------------------------------------------
00475381   1/1  ----------------------------------------------------------------------
00414121   1/1  ----------------------------------------------------------------------
00437941   1/1  ----------------------------------------------------------------------
00503741   1/1  ----------------------------------------------------------------------
00478441   1/1  ----------------------------------------------------------------------
00512891   1/1  ----------------------------------------------------------------------
00515531   1/1  ----------------------------------------------------------------------
00368571   1/1  ----------------------------------------------------------------------
00515511   1/1  ----------------------------------------------------------------------
00489571   1/1  ----------------------------------------------------------------------
00356411   1/1  ----------------------------------------------------------------------
00379961   1/1  ----------------------------------------------------------------------
00477971   1/1  ----------------------------------------------------------------------
00484101   1/1  ----------------------------------------------------------------------
00379261   1/1  ----------------------------------------------------------------------
00405881   1/1  ----------------------------------------------------------------------
00477011   1/1  ----------------------------------------------------------------------
00434401   1/1  ----------------------------------------------------------------------
00490731   1/1  ----------------------------------------------------------------------
00404191   1/1  ----------------------------------------------------------------------
00487021   1/1  ----------------------------------------------------------------------
00533501   1/1  ----------------------------------------------------------------------
00495771   1/1  ----------------------------------------------------------------------
00499191   1/1  ----------------------------------------------------------------------
00432181   1/1  ----------------------------------------------------------------------
00493431   1/1  ----------------------------------------------------------------------
00513761   1/1  ----------------------------------------------------------------------
00392701   1/1  ----------------------------------------------------------------------
00510561   1/1  ----------------------------------------------------------------------
00464411   1/1  ----------------------------------------------------------------------
00444381   1/1  ----------------------------------------------------------------------
00496571   1/1  ----------------------------------------------------------------------
00532471   1/1  ----------------------------------------------------------------------
00406781   1/1  ......................................................................
00439861   1/1  ----------------------------------------------------------------------
00470731   1/1  ----------------------------------------------------------------------
00498811   1/1  ----------------------------------------------------------------------
00394721   1/1  ----------------------------------------------------------------------
00498531   1/1  ----------------------------------------------------------------------
00513251   1/1  ----------------------------------------------------------------------
00489631   1/1  ----------------------------------------------------------------------
00420941   1/1  ----------------------------------------------------------------------
00480441   1/1  ----------------------------------------------------------------------
00468951   1/1  ----------------------------------------------------------------------
00517691   1/1  ----------------------------------------------------------------------
00386741   1/1  ----------------------------------------------------------------------
00476071   1/1  ----------------------------------------------------------------------
00482721   1/1  ----------------------------------------------------------------------
00527261   1/1  ----------------------------------------------------------------------
00437921   1/1  ----------------------------------------------------------------------
00508671   1/1  ----------------------------------------------------------------------
00367291   1/1  ----------------------------------------------------------------------
00409841   1/1  ----------------------------------------------------------------------
00480251   1/1  ----------------------------------------------------------------------
00410531   1/1  ----------------------------------------------------------------------
00478081   1/1  ----------------------------------------------------------------------
00410321   1/1  ----------------------------------------------------------------------
00437901   1/1  ----------------------------------------------------------------------
00521551   1/1  ----------------------------------------------------------------------
00471271   1/1  ----------------------------------------------------------------------
00533151   1/1  ----------------------------------------------------------------------
00401211   1/1  ----------------------------------------------------------------------
00473941   1/1  ----------------------------------------------------------------------
00461621   1/1  ----------------------------------------------------------------------
00402371   1/1  ----------------------------------------------------------------------
00499331   1/1  ----------------------------------------------------------------------
00487061   1/1  ----------------------------------------------------------------------
00515351   1/1  ----------------------------------------------------------------------
00403151   1/1  ----------------------------------------------------------------------
00519581   1/1  ----------------------------------------------------------------------
00496061   1/1  ----------------------------------------------------------------------
00378621   1/1  ----------------------------------------------------------------------
00478391   1/1  ----------------------------------------------------------------------
00472911   1/1  ----------------------------------------------------------------------
00469161   1/1  ----------------------------------------------------------------------
00509891   1/1  ----------------------------------------------------------------------
00470231   1/1  ----------------------------------------------------------------------
00387321   1/1  ----------------------------------------------------------------------
00418301   1/1  ----------------------------------------------------------------------
00523461   1/1  ----------------------------------------------------------------------
00497571   1/1  ----------------------------------------------------------------------
00416171   1/1  ----------------------------------------------------------------------
00511381   1/1  ----------------------------------------------------------------------
00482661   1/1  ----------------------------------------------------------------------
00489391   1/1  ----------------------------------------------------------------------
00444821   1/1  ----------------------------------------------------------------------
00497591   1/1  ----------------------------------------------------------------------
00526911   1/1  ----------------------------------------------------------------------
00357861   1/1  ----------------------------------------------------------------------
00447401   1/1  ----------------------------------------------------------------------
00457851   1/1  ----------------------------------------------------------------------
00430121   1/1  ----------------------------------------------------------------------
00515821   1/1  ----------------------------------------------------------------------
00517931   1/1  ----------------------------------------------------------------------
00378841   1/1  ----------------------------------------------------------------------
00465511   1/1  ----------------------------------------------------------------------
00518311   1/1  ----------------------------------------------------------------------
00514481   1/1  ----------------------------------------------------------------------
00420081   1/1  ----------------------------------------------------------------------
00528321   1/1  ----------------------------------------------------------------------
00407471   1/1  ----------------------------------------------------------------------
00516041   1/1  ----------------------------------------------------------------------
00449901   1/1  ----------------------------------------------------------------------
00517041   1/1  ----------------------------------------------------------------------
00519521   1/1  ----------------------------------------------------------------------
00517841   1/1  ----------------------------------------------------------------------
00424711   1/1  ----------------------------------------------------------------------
00528591   1/1  ----------------------------------------------------------------------
00402391   1/1  ----------------------------------------------------------------------
00488191   1/1  ----------------------------------------------------------------------
00518321   1/1  ----------------------------------------------------------------------
00484261   1/1  ----------------------------------------------------------------------
00494041   1/1  ----------------------------------------------------------------------
00481801   1/1  ----------------------------------------------------------------------
00481131   1/1  ----------------------------------------------------------------------
00372481   1/1  ----------------------------------------------------------------------
00520981   1/1  ----------------------------------------------------------------------
00481541   1/1  ----------------------------------------------------------------------
00531961   1/1  ----------------------------------------------------------------------
00442331   1/1  ----------------------------------------------------------------------
00396721   1/1  ----------------------------------------------------------------------
00498681   1/1  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           TDNIVGITDWIFAQRGRDYVKLHEQNEEKLMDVQEKLHHFDQIRDYLLQLVFMLVVVSFILWGGTYLGGS
00422801   1/1  ----------------------------------------------------------------------
00482201   1/1  ----------------------------------------------------------------------
00379581   1/1  ----------------------------------------------------------------------
00530591   1/1  ----------------------------------------------------------------------
00509431   1/1  ----------------------------------------------------------------------
00367901   1/1  ----------------------------------------------------------------------
00490801   1/1  ----------------------------------------------------------------------
00390411   1/1  ----------------------------------------------------------------------
00510251   1/1  ----------------------------------------------------------------------
00378981   1/1  ----------------------------------------------------------------------
00475891   1/1  ----------------------------------------------------------------------
00420701   1/1  ----------------------------------------------------------------------
00482261   1/1  ----------------------------------------------------------------------
00440861   1/1  ----------------------------------------------------------------------
00500441   1/1  ----------------------------------------------------------------------
00475991   1/1  ----------------------------------------------------------------------
00466971   1/1  ----------------------------------------------------------------------
00425571   1/1  ----------------------------------------------------------------------
00458601   1/1  ----------------------------------------------------------------------
00502741   1/1  ----------------------------------------------------------------------
00379601   1/1  ----------------------------------------------------------------------
00436071   1/1  ----------------------------------------------------------------------
00404101   1/1  ----------------------------------------------------------------------
00466931   1/1  ----------------------------------------------------------------------
00424961   1/1  ----------------------------------------------------------------------
00468691   1/1  ----------------------------------------------------------------------
00436511   1/1  ----------------------------------------------------------------------
00361211   1/1  ----------------------------------------------------------------------
00485451   1/1  ----------------------------------------------------------------------
00469451   1/1  ----------------------------------------------------------------------
00372301   1/1  ----------------------------------------------------------------------
00367481   1/1  ----------------------------------------------------------------------
00422141   1/1  ----------------------------------------------------------------------
00498251   1/1  ----------------------------------------------------------------------
00485931   1/1  ----------------------------------------------------------------------
00468601   1/1  ----------------------------------------------------------------------
00488521   1/1  ----------------------------------------------------------------------
00448931   1/1  ----------------------------------------------------------------------
00437981   1/1  ----------------------------------------------------------------------
00422811   1/1  veslsgirtvkafgaeerelerfeealdelrkaslklarlsallspllqllsalalalvlllgallvlng
00426051   1/1  ----------------------------------------------------------------------
00381441   1/1  ----------------------------------------------------------------------
00503371   1/1  ----------------------------------------------------------------------
00496111   1/1  ----------------------------------------------------------------------
00500611   1/1  ----------------------------------------------------------------------
00495371   1/1  ----------------------------------------------------------------------
00530601   1/1  selnsllveslsgirtvkafgaeerelerfdealdellkaslklarlsallspllellsalalalvlllg
00451571   1/1  ----------------------------------------------------------------------
00371631   1/1  ----------------------------------------------------------------------
00464791   1/1  ----------------------------------------------------------------------
00532531   1/1  ----------------------------------------------------------------------
00368501   1/1  ----------------------------------------------------------------------
00480471   1/1  ----------------------------------------------------------------------
00475371   1/1  ----------------------------------------------------------------------
00457311   1/1  ----------------------------------------------------------------------
00387201   1/1  ----------------------------------------------------------------------
00475521   1/1  ----------------------------------------------------------------------
00495031   1/1  ----------------------------------------------------------------------
00462761   1/1  ----------------------------------------------------------------------
00478411   1/1  ----------------------------------------------------------------------
00475381   1/1  ----------------------------------------------------------------------
00414121   1/1  ----------------------------------------------------------------------
00437941   1/1  ----------------------------------------------------------------------
00503741   1/1  ----------------------------------------------------------------------
00478441   1/1  ----------------------------------------------------------------------
00512891   1/1  ----------------------------------------------------------------------
00515531   1/1  ----------------------------------------------------------------------
00368571   1/1  ----------------------------------------------------------------------
00515511   1/1  ----------------------------------------------------------------------
00489571   1/1  ----------------------------------------------------------------------
00356411   1/1  ----------------------------------------------------------------------
00379961   1/1  ----------------------------------------------------------------------
00477971   1/1  ----------------------------------------------------------------------
00484101   1/1  ----------------------------------------------------------------------
00379261   1/1  ----------------------------------------------------------------------
00405881   1/1  ----------------------------------------------------------------------
00477011   1/1  ----------------------------------------------------------------------
00434401   1/1  ----------------------------------------------------------------------
00490731   1/1  ----------------------------------------------------------------------
00404191   1/1  ----------------------------------------------------------------------
00487021   1/1  ----------------------------------------------------------------------
00533501   1/1  ----------------------------------------------------------------------
00495771   1/1  ----------------------------------------------------------------------
00499191   1/1  ----------------------------------------------------------------------
00432181   1/1  ----------------------------------------------------------------------
00493431   1/1  ----------------------------------------------------------------------
00513761   1/1  ----------------------------------------------------------------------
00392701   1/1  ----------------------------------------------------------------------
00510561   1/1  ----------------------------------------------------------------------
00464411   1/1  ----------------------------------------------------------------------
00444381   1/1  ----------------------------------------------------------------------
00496571   1/1  ----------------------------------------------------------------------
00532471   1/1  ----------------------------------------------------------------------
00406781   1/1  ......................................................................
00439861   1/1  ----------------------------------------------------------------------
00470731   1/1  ----------------------------------------------------------------------
00498811   1/1  ----------------------------------------------------------------------
00394721   1/1  ----------------------------------------------------------------------
00498531   1/1  ----------------------------------------------------------------------
00513251   1/1  ----------------------------------------------------------------------
00489631   1/1  ----------------------------------------------------------------------
00420941   1/1  ----------------------------------------------------------------------
00480441   1/1  ----------------------------------------------------------------------
00468951   1/1  ----------------------------------------------------------------------
00517691   1/1  ----------------------------------------------------------------------
00386741   1/1  ----------------------------------------------------------------------
00476071   1/1  ----------------------------------------------------------------------
00482721   1/1  ----------------------------------------------------------------------
00527261   1/1  ----------------------------------------------------------------------
00437921   1/1  ----------------------------------------------------------------------
00508671   1/1  ----------------------------------------------------------------------
00367291   1/1  ----------------------------------------------------------------------
00409841   1/1  ----------------------------------------------------------------------
00480251   1/1  ----------------------------------------------------------------------
00410531   1/1  ----------------------------------------------------------------------
00478081   1/1  ----------------------------------------------------------------------
00410321   1/1  ----------------------------------------------------------------------
00437901   1/1  ----------------------------------------------------------------------
00521551   1/1  ----------------------------------------------------------------------
00471271   1/1  ----------------------------------------------------------------------
00533151   1/1  ----------------------------------------------------------------------
00401211   1/1  ----------------------------------------------------------------------
00473941   1/1  ----------------------------------------------------------------------
00461621   1/1  ----------------------------------------------------------------------
00402371   1/1  ----------------------------------------------------------------------
00499331   1/1  ----------------------------------------------------------------------
00487061   1/1  ----------------------------------------------------------------------
00515351   1/1  ----------------------------------------------------------------------
00403151   1/1  ----------------------------------------------------------------------
00519581   1/1  ----------------------------------------------------------------------
00496061   1/1  ----------------------------------------------------------------------
00378621   1/1  ----------------------------------------------------------------------
00478391   1/1  ----------------------------------------------------------------------
00472911   1/1  ----------------------------------------------------------------------
00469161   1/1  ----------------------------------------------------------------------
00509891   1/1  ----------------------------------------------------------------------
00470231   1/1  ----------------------------------------------------------------------
00387321   1/1  ----------------------------------------------------------------------
00418301   1/1  ----------------------------------------------------------------------
00523461   1/1  ----------------------------------------------------------------------
00497571   1/1  ---aselvqwlldlgildeseilledlenalalllsligaklvkdllllvlkyl................
00416171   1/1  ----------------------------------------------------------------------
00511381   1/1  ----------------------------------------------------------------------
00482661   1/1  ----------------------------------------------------------------------
00489391   1/1  ----------------------------------------------------------------------
00444821   1/1  ----------------------------------------------------------------------
00497591   1/1  ----------------------------------------------------------------------
00526911   1/1  ----------------------------------------------------------------------
00357861   1/1  ----------------------------------------------------------------------
00447401   1/1  ----------------------------------------------------------------------
00457851   1/1  ----------------------------------------------------------------------
00430121   1/1  ----------------------------------------------------------------------
00515821   1/1  ----------------------------------------------------------------------
00517931   1/1  ----------------------------------------------------------------------
00378841   1/1  ----------------------------------------------------------------------
00465511   1/1  ----------------------------------------------------------------------
00518311   1/1  ----------------------------------------------------------------------
00514481   1/1  ----------------------------------------------------------------------
00420081   1/1  ----------------------------------------------------------------------
00528321   1/1  ----------------------------------------------------------------------
00407471   1/1  ----------------------------------------------------------------------
00516041   1/1  ----------------------------------------------------------------------
00449901   1/1  ----------------------------------------------------------------------
00517041   1/1  ----------------------------------------------------------------------
00519521   1/1  ----------------------------------------------------------------------
00517841   1/1  ----------------------------------------------------------------------
00424711   1/1  ----------------------------------------------------------------------
00528591   1/1  ----------------------------------------------------------------------
00402391   1/1  ----------------------------------------------------------------------
00488191   1/1  ----------------------------------------------------------------------
00518321   1/1  ----------------------------------------------------------------------
00484261   1/1  ----------------------------------------------------------------------
00494041   1/1  ----------------------------------------------------------------------
00481801   1/1  ----------------------------------------------------------------------
00481131   1/1  ----------------------------------------------------------------------
00372481   1/1  ----------------------------------------------------------------------
00520981   1/1  ----------------------------------------------------------------------
00481541   1/1  ----------------------------------------------------------------------
00531961   1/1  ----------------------------------------------------------------------
00442331   1/1  ----------------------------------------------------------------------
00396721   1/1  ----------------------------------------------------------------------
00498681   1/1  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           NGVYTGLANWIAAFVLCLFPVVDAFAVIPAASQETNVYKDSLVRLNRLQDNSFEEEKSEIKLIAPYDIKL
00422801   1/1  -------------------------------------------------------------------lll
00482201   1/1  ------------------------------------------------------------------llll
00379581   1/1  -------------------------------------------------------------------lep
00530591   1/1  ---------------------------------------------------llllllaleelpllgelll
00509431   1/1  -------------------------------------------------------------------Mle
00367901   1/1  -------------------------------------------------------------------lel
00490801   1/1  -------------------------------------------------------------------lll
00390411   1/1  ---------------------------------------------------------------------M
00510251   1/1  -------------------------------------------------------------------lll
00378981   1/1  -------------------------------------------------------------------lpl
00475891   1/1  ---------------------------------------------------------------lllelll
00420701   1/1  -------------------------------------------------------------------lpl
00482261   1/1  -------------------------------------------------------------------lll
00440861   1/1  ---------------------------------------------------------Mpllslgepllel
00500441   1/1  ---------------------------------------------------------------lllelll
00475991   1/1  -------------------------------------------------------lllaaelpelgelll
00466971   1/1  ----------------------------------------------------------------llalll
00425571   1/1  -------------------------------------------------------------------lel
00458601   1/1  ---------------------------------------------------------------------l
00502741   1/1  -------------------------------------------------------------------lll
00379601   1/1  -----------------llllpllllpdeplaaldvalqralvslerllellvdpgasdihinpggpvrv
00436071   1/1  -------------------------------------------------------------------pll
00404101   1/1  --------------------------------------------------------------------el
00466931   1/1  ----------------------------------------------------------------------
00424961   1/1  --------------------------------------------lgepldglgplr......papgllel
00468691   1/1  ---------------------------------------------------------------lsvpvgl
00436511   1/1  --------------------------------ievpvglallgrvldllgepid..gkgplelgepllev
00361211   1/1  ----------------------------------------------------------plellgepllel
00485451   1/1  ----------------------------------------------------------------------
00469451   1/1  ------------------------------------------------------------------alle
00372301   1/1  -------------------------------------------------------------------yvl
00367481   1/1  -------------------------------------------------------------------yvr
00422141   1/1  ---------------------------------------------------dlsleelekllelllrdll
00498251   1/1  ------------------------------------------------------------------vekl
00485931   1/1  ----------------------------------------------------------------------
00468601   1/1  ----------------------------------------------------------------------
00488521   1/1  ---------------------------------------------------------lllllalelllev
00448931   1/1  ----------------------------------------------------------------------
00437981   1/1  ---------------------------------------------------------------lveklrp
00422811   1/1  eltvgdlvafllyalqllgplsqlgsllsel.......................................
00426051   1/1  ----------------------------------------------------------------------
00381441   1/1  ----------------------------------------------------------------------
00503371   1/1  ----------------------------------------------------------------------
00496111   1/1  --------------------------------------------------------------------el
00500611   1/1  ---------------------------------------------------------pgllsllelllel
00495371   1/1  ------------------------------------------------------------esalelllel
00530601   1/1  aylvln..gelt..vgdlvafllyalrllgplrqlgsllselqralaaaerifelld...P.E....---
00451571   1/1  ----------------------------------------------------------------------
00371631   1/1  ------------------------------------------------------------------msel
00464791   1/1  -------------------------lsvpvgdkllGrvldvlgepidglgpllalerlpierlappllel
00532531   1/1  ----------------------------------------------------------------------
00368501   1/1  -------------------------------------------------------------kerllllel
00480471   1/1  ----------------------------------------------------------------------
00475371   1/1  ----------------------------------------------------------------------
00457311   1/1  ----------------------------------------------------------------------
00387201   1/1  -----------------------------------------------------------------mssge
00475521   1/1  ----------------------------------------------------------------------
00495031   1/1  --------------------------------------------------------------lsalelll
00462761   1/1  ----------------------------------------------------------------------
00478411   1/1  ----------------------------------------------------------------------
00475381   1/1  ----------------------------------------------------------------------
00414121   1/1  ----------------------------------------------------------------------
00437941   1/1  --------------------------------------------------------------lrplvekl
00503741   1/1  ---------------------------------------------------------------------f
00478441   1/1  ----------------------------------------------------------------------
00512891   1/1  ----------------------------------------------------------------------
00515531   1/1  ----------------------------------------------------------------------
00368571   1/1  ------------------------------------------llgvrllpplppklagllplagladgd.
00515511   1/1  ----------------------------------------------------------------------
00489571   1/1  ----------------------------------------------------------------------
00356411   1/1  ---------------------------------------------------------------------l
00379961   1/1  ---------------------------------------------------------------------y
00477971   1/1  ----------------------------------------------------------------------
00484101   1/1  ----------------------------------------------------------------------
00379261   1/1  --------------------------------------------------------------drllleel
00405881   1/1  ----------------------------------------------------------------------
00477011   1/1  ----------------------------------------------------------------------
00434401   1/1  ----------------------------------------------------------------------
00490731   1/1  ----------------------------------------------------------------------
00404191   1/1  -------------------------------------------------------------vellpkvtl
00487021   1/1  ----------------------------------------------------------------------
00533501   1/1  ----------------------------------------------------------------------
00495771   1/1  ----nellrpivanvdlvlivvdardplfslnlllrylvlaeaagippvlvlnKiDlleeeedlelleel
00499191   1/1  ----------------------------------------------------------------------
00432181   1/1  ----------------------------------------------------------------------
00493431   1/1  ----------------------------------------------------------------------
00513761   1/1  ----------------------------------------------------------------------
00392701   1/1  ----------------------------------------------------------------------
00510561   1/1  --------------------------------------ldglgepldgllpilaklfrpievlalgller
00464411   1/1  ----------------------------------------------------------------------
00444381   1/1  -----------------------------------------------------------asdelekllel
00496571   1/1  ----------------------------------------------------------------------
00532471   1/1  ----------------------------------------------------------------------
00406781   1/1  ......................................................................
00439861   1/1  --------------------------------------------------------------------kl
00470731   1/1  ----------------------------------------------------------------------
00498811   1/1  ----------------------------------------------------------------------
00394721   1/1  ------------------------------------------------------lvslleslelpllekl
00498531   1/1  --------------------------------------ldklgkildlalkileksflklevlalgvler
00513251   1/1  ----------------------------------------------------------------------
00489631   1/1  ----------------------------------------------------------------------
00420941   1/1  ---------------------------------------------------------------------l
00480441   1/1  ----------------------------------------------------------------------
00468951   1/1  --------------------------------------------------------------lnvlgesi
00517691   1/1  ----------------------------------------------------------------------
00386741   1/1  --------------------------------------------------------------------kl
00476071   1/1  ----------------------------------------------------------------------
00482721   1/1  ----------------------------------------------------------------------
00527261   1/1  ----------------------------------------------------------------npfilg
00437921   1/1  -------------------------------------------------------------lglllvekl
00508671   1/1  ----------------------------------------------------------------------
00367291   1/1  ----------------------------------------------------------------------
00409841   1/1  ----------------------------------------------------------------------
00480251   1/1  ----------------------------------------------------------------------
00410531   1/1  ----------------------------------------------------------------------
00478081   1/1  ----------------------------------------------------------------------
00410321   1/1  ----------------------------------------------------------------------
00437901   1/1  ----------------------------------------------------------------------
00521551   1/1  ----------------------------------------------------------------plvekl
00471271   1/1  ----------------------------------------------------------------praile
00533151   1/1  ----------------------------------------------------------------------
00401211   1/1  ----------------------------------------------------------------------
00473941   1/1  -------------------------------------------------------------------ekl
00461621   1/1  ----------------------------------------------------------------------
00402371   1/1  -----------------------------------------------------vlektgipltkllrpvl
00499331   1/1  ----------------------------------------------------------------------
00487061   1/1  ----------------------------------------------------------------------
00515351   1/1  ----------------------------------------------------------------------
00403151   1/1  ----------------------------------------------------------------------
00519581   1/1  ----------------------------------------------------------------------
00496061   1/1  ----------------------------------------------------------------------
00378621   1/1  ----------------------------------------------------------------------
00478391   1/1  ----------------------------------------------------------------------
00472911   1/1  ----------------------------------------------------------------------
00469161   1/1  ----------------------------------------------------------------------
00509891   1/1  ----------------------------------------------------------------------
00470231   1/1  ----------------------------------------------------------------------
00387321   1/1  ----------------------------------------------------------------------
00418301   1/1  --------------------------------------------------------------drpllekl
00523461   1/1  ----------------------------------------------------------------------
00497571   1/1  ......................................................psllslldvlrpkvdf
00416171   1/1  ----------------------------------------------------------------------
00511381   1/1  ----------------------------------------------------------------------
00482661   1/1  ----------------------------------------------------------kkvaivllsnya
00489391   1/1  ----------------------------------------------------------------------
00444821   1/1  ----------------------------------------------------------------------
00497591   1/1  ----reelrlvaanvdvvllvvdardplfslnlllrylvlaeaggipvilvlnKiDllddeeleellell
00526911   1/1  ----------------------------------------------------------------------
00357861   1/1  ----------------------------------------------------------------------
00447401   1/1  ----------------------------------------------------------------------
00457851   1/1  ----------------------------------------------------------------------
00430121   1/1  ------------------------------------------iPvsklleddrplleklrpvlfddvvgq
00515821   1/1  ----------------------------------------------------------------------
00517931   1/1  ----------------------------------------------------------------------
00378841   1/1  ----------------------------------------------------------------------
00465511   1/1  ----------------------------------------------------------------------
00518311   1/1  ----------------------------------------------------------------------
00514481   1/1  ----------------------------------------------------------------------
00420081   1/1  ----------------------------------------------------------------------
00528321   1/1  ----------------------------------------------------------------------
00407471   1/1  ----------------------------------------------------------------------
00516041   1/1  ----------------------------------------------------------------------
00449901   1/1  ----------------------------------------------------------------------
00517041   1/1  ----------------------------------------------------------------------
00519521   1/1  ----------------------------------------------------------------------
00517841   1/1  ----------------------------------------------------------------------
00424711   1/1  ----------------------------------------------------------------------
00528591   1/1  ----------------------------------------------------------------------
00402391   1/1  ----------------------------------------------------------------------
00488191   1/1  ----------------------------------------------------------------------
00518321   1/1  ----------------------------------------------------------------------
00484261   1/1  ----------------------------------------------------------------------
00494041   1/1  ----------------------------------------------------------------------
00481801   1/1  ----------------------------------------------------------------------
00481131   1/1  ----------------------------------------------------------------------
00372481   1/1  ----------------------------------------------------------------------
00520981   1/1  ----------------------------------------------------------------------
00481541   1/1  ----------------------------------------------------------------------
00531961   1/1  ----------------------------------------------------------------------
00442331   1/1  ----------------------------------------------------------------------
00396721   1/1  ----------------------------------------------------------------------
00498681   1/1  ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           DNVHFRYENGSREILKGINLDISSGDKLAILGRSGSGKSTLANLIRGDRVATEGAITINGIDVSKVGDQI
00422801   1/1  lllallllllllllldpllelenlsksyggrlvlalkdvsltvkpgeivalvGpnGsGKSTllkllagll
00482201   1/1  elknlsksyggvlalkdvsltikpgeivalvGpnGsGKSTllkllagllkptsGeilldgkdilglslke
00379581   1/1  llevenlsksy..ggvlalkdvsltvkpgeivalvGpnGsGKSTllkllagllkptsGeilldgldital
00530591   1/1  evknlsksyggvlalkdvsltikpgeivalvGpnGsGKSTllkllagllkptsGeilldgkditdlslke
00509431   1/1  lknlslsnfr....vlkdelvslefepg.ltaivGpNGsGKStlldalagllggrslrllragglsdlif
00367901   1/1  knlslsy..g.ksilkdvsleip.geltalvGpnGsGKStllkalagllgpdvsallrlsglidlilkgl
00490801   1/1  lllllalllelleeeeellllllalllllgdpllelenlsksy..ggvpalkdvsltikpGeivalvGpn
00390411   1/1  knlslrygn..fralkdvslelppG.ltalvGpNGsGKStLlkalagllgpdsglrvgklsdlirrgadk
00510251   1/1  llllllaeellelleeeelllllllllllllgdpllelenlsksy..ggvpalkdvsltikpGeivalvG
00378981   1/1  lelenlsksy..ggvlalkdvsltvepgeivalvGpnGaGKSTllkllagllkptsGeilldgldlllls
00475891   1/1  evknlsksyggvlalkdvsltikpgeivalvGpnGsGKSTllkllagllkptsGeilldgkdilglslle
00420701   1/1  lelenlsksypgggvlalkdvsltvepgeivalvGpnGsGKSTllkllagllkptsGeilldgldlllls
00482261   1/1  evenlsksyggvlalkdvsltikpgeivalvGpnGsGKSTllkllagllkptsGeilldgkdildlslae
00440861   1/1  enlsksy..ggvvalkdislsipkGeildlldellellkeldgsllnvalvGpsGsGKStLlnaLlgllk
00500441   1/1  elknlsksyggvlalddvsltikpgeivalvGpnGaGKSTllkllagllkptsGeilldgkdildlsl.l
00475991   1/1  evvnlsksyggvlalkdvsltikpgeivalvGpnGsGKSTllkllagllkptsGeilldgkdildlslae
00466971   1/1  evknlsksyggvlalkdvsltikpgeivalvGpnGsGKSTllkllagllkptsGeilldgkdilglslae
00425571   1/1  enlsksy..ggvlalkdvsltvepgeivalvGpnGaGKSTllkllagllkptsGeilldgldllalsl.l
00458601   1/1  llevenlsksyggvlalkdvsltikpgeivalvGpnGsGKSTllkllagllkptsGeilldgkditglsp
00502741   1/1  evenlsksyggvlalkdvsltikpgeivalvGpnGsGKSTllkllagllkptsGeilldgkdilglslae
00379601   1/1  ridgvlelllvvldllsldleellalasriavlagrdiserrlpldgallpdgsrvrvrlsplptllgge
00436071   1/1  elenlsksygg...lalkdvsltvepgeivalvGpnGaGKsTllkllagllkptsgeilldgldlla...
00404101   1/1  enlsksy..ggvlalkdvsltvepgeivalvGpnGaGKSTllkllagll.ptsGeilldgldltalslae
00466931   1/1  ----Mkllslslgnfralkdvslelp.geltalvGpNGsGKStLlkalagllgpdsGeilldgkdilals
00424961   1/1  envsksygtg..ialidlslpigkGervalvGpsGaGKttLlrliaglldpdsgeilldgvdigersrev
00468691   1/1  allgrvldvlgepidglgplllllllpivrlappllelenlsksygtg..ialidvsltigrGervglvG
00436511   1/1  enlsksyggrklvlepletgialddvsltikkGervglvGpsGaGKtTLlkllagllkpdsGeilvdgli
00361211   1/1  enlsksyg..gitalddvslgirkGeivllvGpsGsGKStllrnllagllaptggsvlldgleisalsla
00485451   1/1  ----skiygd...ealkdvsleikkllnlsgkpgeiigivGpsGsGKsTllrlLagllkpllltggkvlv
00469451   1/1  lenlskiy.ggvpkalddvslgiepGeivalvGpsGsGKstllrllagllaglptsGeillldgkdvlyl
00372301   1/1  Pllsdgmpllelenlrkpy..ggllvlndvsl...pgeivaltGpnGaGKSTllrllaglllpasggilv
00367481   1/1  PelldepllelengrhPllsksy..ggkvvlndislsip.gellvitGPngsGKSTllralaglllpasg
00422141   1/1  glgplvklldplleeavvngasdihiepgggllrvryridgvlielifldeeellallsrlkslaglpil
00498251   1/1  lglalllieklflkvlprllsllelenlskiy..tgipal.dvslglgGlppGeivlllGpsGsGKTtLa
00485931   1/1  -------------------LsvpkgevvalvGpnGaGKTTllallagllaptggkvllvgadi.......
00468601   1/1  ----------------dlslevkkgevialvGpnGvGKTTllakLagllapqggkvlllgaDiyraaaae
00488521   1/1  enlrist..gikeldkllsgglppgeitlivGpsGsGKTtLllqlavngllppdsGei............
00448931   1/1  --------------LddvslsvepgevialvGpnGsGKTTllnalagllapdggkvllvgadiarla..a
00437981   1/1  knldkvi..gqeealkdlslalkpgeiphalllvGppGsGKttlaralagllgpdsgkilldgkdi....
00422811   1/1  ......................................................................
00426051   1/1  ----------------------kpgevialvGpsGsGKSTlakllakelglefidsgdilrdgvdlgges
00381441   1/1  ------------------------GeliaivGpsGsGKsTLlklLagllppdsgsigslttrlprlgevd
00503371   1/1  -------------Mmlkslelknfkslkdvsligdfspg.ltaivGpNGsGKStlldaiagllgpdsgei
00496111   1/1  enltkly..tgikaLddllslgippGeivllvGpsGsGKTtlalrllagllkptggkvliiglelsaeel
00500611   1/1  enltklp..tgipaLddv.lgggipkGeivllvGpsGsGKTtlllqlagllapdsgeillggkvlyisle
00495371   1/1  edltkls..tgikaLddv.lggglpkGeivlllGpsGsGKttlalrllagllkp...evlvdgldltgls
00530601   1/1  ----------------------------------------------------------------------
00451571   1/1  -------------------MsikkgeiiaivGppGsGKsTlaklLakll....glivldgddl......l
00371631   1/1  iiylelselewallradvgltlteaelkrlkglndlleledlskiygplsrlikllleellrllgklald
00464791   1/1  enlskrfgtgi..vlidvslpigkGervglvGpnGaGKTtLlkllagllkpdsgeivvyg.ligerprev
00532531   1/1  -----------vlalkdvslviekGevvallGlSGsGKTTLlrllagllipddgeilidggdinleggfy
00368501   1/1  rnvllddviGqeeakealsealelplkrpelfdglgvelpgknvlLvGppGvGKTtlaralakll..gap
00480471   1/1  ------------------sleikkgekvaivGpsGsGKSTLlnaLagllsptsvpettrdfilgeilldg
00475371   1/1  -------------alddvslsikkgevialvGkgGvGKTTlaanlagllaptggkvlligaDi.......
00457311   1/1  ----------------------mkkgeiigivGpsGsGKSTlarllagllekpgsgvividgddlyklsr
00387201   1/1  pllevenlskry..ggklalkdvslsvekgeivlLlGpnGaGKTtLlralagllgptsfvvsptftlvre
00475521   1/1  -----------evlalhgvsldve.gevvllvGpsGsGKStllralag.....sGeilvdg.dlv.dlep
00495031   1/1  eledltkis..tgipaLddvlsggipkGelvllvGpsGsGKTtlllqlagllalglgliplggkvlyigl
00462761   1/1  --------yygdvtaldgvsltikkgevialvGpsGsGKsTlaraLagllpeepgsgvvlldgddlr...
00478411   1/1  ---------Ggvlalhgvsldve.gevvlltGpsGsGKStllralagl.....Gtilldg.dlvrlglkd
00475381   1/1  ----------------------mkgeiialtGpsGsGKsTlarlLagllkptsgivsvdglrlavlsrdl
00414121   1/1  ----------------------kpgevvllvGpsGaGKTTLlrallglleglkvaviepdfgeilidgql
00437941   1/1  rpknlddvygqeevlkalslalekgrpehlllvGppGtGKTtlakalaglllptsggvrvlgidaselld
00503741   1/1  ifldlrplallplpdrlvgrdeeiealskalgg....aldgvslsiepggivllvGppGvGKTtLaklla
00478441   1/1  ---------aevlalhgvsldin.gegvlivGpsGsGKStlalaLagl.....Gailvdd.dlvll.elr
00512891   1/1  -------------------------evilltGppGvGKTTlakalagelgakfgsvsltgrdv....rsa
00515531   1/1  -----------------------kgekvallGlsgsGKSTllnrllglefaygpTigptsgtieidgvkl
00368571   1/1  ...glgvllGkll..dgvpvtldlgelgrhllivGptGsGKStllrllaglllpdggrviviDpkgeyag
00515511   1/1  -----------------------kgekvlllGlsgsGKSTllnrllgleflpgpTigptegtieidgvkl
00489571   1/1  rvknlsksy..ggktalddvslsvepG.ivgLlGpNGaGKSTllrllaGllkpt................
00356411   1/1  knlsksyg..ilkalkdislelkkgikilllGlsgsGKSTllnrllgleygpTiginegtieidgvkltl
00379961   1/1  rpvdfddivGqeealralslalaagppegvllvGppGtGKstlaralagllppdsgrivlvgnlsdlldp
00477971   1/1  ----------------------hkgelvvlvGPsGaGKsTLlnaLlgll.ptsgvisvsgttrpprpgev
00484101   1/1  ------------------------kgpvigivGpsGsGKTTllraLagllkprggrvavigldigrldld
00379261   1/1  rpvllddviGqeeakealsealrlplkrlelferlglrrpgknvlLvGppGvGKTtlaralAkllgapfv
00405881   1/1  ------------------------gervglvGrpgaGKSTLlnaltglkaivsgyp..........gttl
00477011   1/1  --eelrklldlidklrdlllsldlglpkvaivGrsgsGKSTLlnallGldvlpvgggpgtrrptelrlse
00434401   1/1  ----lsksyggllalddvslsvkkgliigitGpsGsGKTTlaraLaellrerggsvavidlddfyrpaae
00490731   1/1  ----------------dvslsvkkgkvialvGkgGvGKTTlaaklagllakrggkvllidaDp.......
00404191   1/1  ddlvgleelkealkealellslgikpgeivllyGppGtGKTtlakalanelkkrggrvlyvsa.......
00487021   1/1  --------------------------rmkiivltGpsGsGKsTlarlLaell....gvvvidtddllra.
00533501   1/1  ------------------------rgeiialtGpsGsGKsTlaklLaellphldtgdvlldgepigtp..
00495771   1/1  lkelesi.gvdvvlvsakkgalldilldilkgktvalvGpsGvGKStLlNaLlgellattgeipgdggdg
00499191   1/1  ------------------------kgkiigitGpsGsGKsTlaklLaellgatvgdvd............
00432181   1/1  ------------------slelkkglkvalvGrpgvGKStLlnallglkvaivsdypgttrdptlgvvel
00493431   1/1  -----------------------kGelivllGpsGaGKsTllkllagllgptsgvisvggttreprpgev
00513761   1/1  -------------------------kiiaivGkgGsGKTTllnklaglla.dggkvlvidlDparanlp.
00392701   1/1  --------agarlaledlslgirpgknvlLvGppGvGKTtlaralagllgapfgrvdasd..........
00510561   1/1  ksv.erlstGikaL..DlllgiGglprGelvliaGppGsGKTtlalqlaanlaaqggkvlyisteesleq
00464411   1/1  ----------------------vkkgeiivllGpsGsGKsTlaklLagllgptggsvlltgepvs..gep
00444381   1/1  rpvlledvigqeeakkalslalelplkrlelfgklddligrspairrllellgarpgenvlLvGppGtGK
00496571   1/1  ------------------------GkgelivllGpsGsGKsTlarlLagll...ggsvldtgepirgepl
00532471   1/1  -----------------------pGkiIvitGpsGsGKsTlarlLaellnglggivsvddlgrdvgelgg
00406781   1/1  ...........rlllkdlslgippgknvllvGppGtGKTtlakalagelgvpfvrisase..........
00439861   1/1  eeve.ristgipeldellgGglpkgslilitGppGsGKTtlalqlaanlaknggkv..............
00470731   1/1  -----------arpltfddvvgqdeakeeleellag.llgikkpkvillvGppGsGKTTlaralakel..
00498811   1/1  ------------------------kPgkiigltGpsGsGKsTlarlLae.l....gvividgddltrelv
00394721   1/1  rpvllddvvgreealeallealrrgpprnvlLvGppGvGKTtlakalakelaagsgpilldgvpv.....
00498531   1/1  kev.erlstGikaLDallgiGglprGsltliaGppGsGKTtlalqlaanlaklggkvlyisteesleql.
00513251   1/1  -----------iellsdlslsipspevvllvGppGsGKstlakklaell....gfilidaddlr......
00489631   1/1  -----------------------MkgklillvGppGsGKtTlaraLaell..........glpfiridgd
00420941   1/1  rpvllddvigqeeakeallealalplkrldlglslgirpgkgvllyGppGtGKTtlakalagel..gapf
00480441   1/1  -------------------------rlivllGpsGaGKsTlaklLaell.pglivisvgdttr.eprege
00468951   1/1  dalgkilseilkllekgfltalgllerksv.erlstgikaL..DlllgiGglprGelvlivGppGsGKTt
00517691   1/1  -----------------lsfelkpglnvgivGhvgaGKSTLlnallgllgaivgdvlvdg..........
00386741   1/1  rpvllddvvgqeeakeallealkavllgirpgehllLvGppGtGKTtlaralagel..gapfvrlda...
00476071   1/1  ------------------------kgkiigltGpsGsGKsTlaklLaelglpvidtddltregvll....
00482721   1/1  ------------------------kgkiigltGpsGsGKsTlarlLae.l....glpvidtddlyrelva
00527261   1/1  pkvdledfigreeelkeleeal..pkivlltGprGsGKTtllkalakel..gkpviyidlselsskgyvd
00437921   1/1  rpkllddvvgqeealerlllalkagklphlllvGppGvGKTtlaralarlllgsgggvdvieldasdlrg
00508671   1/1  -----------------hvsllklgeldislsikkgevivlvGpsGsGKsTlaraLakrLeepgsgvvll
00367291   1/1  --vtlddvvgqeeakeallealelalkgldlflslglrpgrnvllyGppGtGKTtlaralanel..gapf
00409841   1/1  -----------------lslelkkglkvalvGrpgvGKSTLlnaLlgadlaivsdipgttrdpilgv...
00480251   1/1  ----------------EdlslavgkgkvialvGkgGvGKTTtaakLaaalaergkkvllidlDpyr....
00410531   1/1  ------------gelknlslelkkglkillvGlngvGKTtllkrlaggefv.dygptigvnfktvevdgv
00478081   1/1  ------------------------gkvivltGppGsGKtTlarlLaellkplgggvvvidtddlrreair
00410321   1/1  --------yggllllkdlslelkkglkilllGlngaGKTTllnrllggefp.eygptig-----------
00437901   1/1  ---------slllvekyrpvllddvvgqeeakeallealalararplkrpelflslgirpgrillLyGpp
00521551   1/1  rpvllddvigqeeakeallealarlkapelflslglrpgkgvlLvGppGtGKTtlaralagll..gapfv
00471271   1/1  lesliksllekllellkrlslklkkglkvalvGrpgvGKStLlnallggdfaevgptp------------
00533151   1/1  ------------------MsldikkgklivltGppGsGKtTlarlLaerlglpfistddllrelvpggld
00401211   1/1  --------------------elkrglnvgivGhvgaGKSTLlnaLlgll.....................
00473941   1/1  rpvllddvvgqeevkkalllalalallrgepgehvlLvGppGtGKTtlaralagll....ga........
00461621   1/1  -----------------------mkgmiialtGppGsGKsTlaklLaerlglpfistddlyrevvergte
00402371   1/1  lddviGqeealeallealrr..rpgrnvllvGppGvGKTtlaralagllvrssgpilldgvpf.......
00499331   1/1  ------------------PslslkkgklivltGppGsGKtTlakaLaerl....glpfidtddllrepvi
00487061   1/1  ----------------------ldMkkgklIvieGppGsGKtTlakaLa.....................
00515351   1/1  ------------------------mngklivltGppGsGKtTlaraLaerlglpvistddllreav...p
00403151   1/1  -----------------------kglkivlvGdsgvGKTtLlnrllgde.fpvsyiptigvdfyvktvei
00519581   1/1  -----------------------kpkvilltGppGvGKttlarlLakll....glpl..iidldalaell
00496061   1/1  ------------------------gklivltGppGsGKtTlaklLaerlglpvistddllre......ev
00378621   1/1  ---------glklllrrlslllkkglkvllvGlpgvGKstllnrlageef..dtpgttiginfgtv----
00478391   1/1  --------------------msikkgklilltGppGsGKtTlaralaerl....glpvidgddllrelvg
00472911   1/1  --------------------mkmkkgklilltGppGsGKtTlaraLaellgapfisgddllrglageggk
00469161   1/1  -------------------------llIvieGppGsGKsTlaklLaerlgltglsvlltredgfgtplge
00509891   1/1  --------------------------pkvigitGpsGsGKTTlanaLarllkarglkvavidrdpgrld.
00470231   1/1  elaellsllierlllrdlllelkll.kvllvGdpnvGKStLlnrl...kivsdpgtTigvvgtveldgvk
00387321   1/1  ---------glkglllrlklelkkllkillvGlpgvGKTtllnrllgdefve..ygptiginfvtv----
00418301   1/1  rpvllddviGqeeakkallealalplkrlelfeklrgirpgknvlLvGppGtGKTtlaralakll..grp
00523461   1/1  ------------------------a.kvalvGlpnvGKStLlnallgdkaivsdipgi------------
00497571   1/1  ddii..leeakeelllellelplklpelfkrlglkapkrrgvlLyGppGtGKTllakalak.elgrlpfi
00416171   1/1  --diigqeeakkallealslaartgenvllvGppGtGKttlaralakllprsgvpfvrvncsalte....
00511381   1/1  ------------------llllkpgglvlitGPtgsGKsttLlralnrleeagkgvilvkdaidtrlgie
00482661   1/1  lsislddlllildlykevqvaydnfykvdesdiayqyallakedenaaaflksnrqkklvrdladrviae
00489391   1/1  -------------------lsikkgklivltGppGsGKtTlakaLaerlglpvistddllr.........
00444821   1/1  --------------------elkkllkvllvGlpgvGKttllnrllggefai..ygptiginfgtv----
00497591   1/1  delslgldvvavsaktglg...idellellkglkvvlvGrsgvGKStLlnallgekvak-----------
00526911   1/1  --------------------------rkvalvGlpnvGKStLlnrllgakvse.pgtT------------
00357861   1/1  --------------------kkdklfkillvGdsgvGKTtLlnrllgdef.lveyiptigidfytk----
00447401   1/1  -----------------------kelkivlvGdsgvGKttLlnrllgnkfivsyipti------------
00457851   1/1  ------------------------PkgklivltGppGsGKtTlakaLaerl..........glpvistdd
00430121   1/1  eeakeallealrrgrkglelgirpggnvllvGPpGvGKTtlakalagllfpsgvpfirinlseltekllv
00515821   1/1  ----------glllllllslelkkllkvalvGlpnvGKstLlnrllgakf.vsrgpTig-----------
00517931   1/1  ----------------------kkllkvalvGlpnvGKstllnrllgdkvsdepgtTid-----------
00378841   1/1  -----------------------kelkillvGdsgvGKstLlnrllgde.fiveyiptigvdvytktvei
00465511   1/1  --------------------ekkrllkvalvGlpnvGKStllnallgakfaivedepgitidinlg.vel
00518311   1/1  -----------------------gelkvvlvGdpnvGKssLlnrllggkfvedypgtt------------
00514481   1/1  ---------------alllslllkkllkvalvGlpnvGKstllnrllggkf.seygtTi-----------
00420081   1/1  --------------------smkkglrIaleGpsGvGKTTlaklLarhlgptggrvllvgEPiaywrsvg
00528321   1/1  -------------------------dkllkvvlvGdpnvGKssLlnrllggkfivsyiptilt-------
00407471   1/1  -------------------------lkvllvGlpnvGKsTLlnrllgdkv.dkpgtTig-----------
00516041   1/1  --------------------mlk.gklillvGppGsGKtTlaralaeel....glpfvvidaddl.lrge
00449901   1/1  -------------------kkkkkllkillvGdsgvGKStLlnrllggkfivsyipti------------
00517041   1/1  ----------------------kkllkvvlvGdpnvGKstLlnrllgdkfivsyipti------------
00519521   1/1  -----------------------kelkilllGlpnvGKstllnrllgeef..dkpgpTrgvnvgtv----
00517841   1/1  ------hgegirdlldlidelrdllerldldlpkiavvGrpnvGKSsLlnallgrd--------------
00424711   1/1  --hskkaldelelvldnadvilevvdardpllsldvrlaellegkprllvlnKaDl--------------
00528591   1/1  ------------sallllllelkkllkvalvGlpnvGKstLlnrllggkf.seygtTig-----------
00402391   1/1  -----------------------kelkvlllGlpnvGKstllnrllggdf.depgtTig-----------
00488191   1/1  -----------fllsllrrlslllkrllkvalvGlpgvGKStLlnallgakflakvspt-----------
00518321   1/1  ------------------msslelkkllkvvlvGdpnvGKstLlnrllggkfvsdypgttvdfnvk----
00484261   1/1  ----------------------kkllkialvGhpnvGKStLlnrltgekv...pgttga-----------
00494041   1/1  ----------------------kkeikilllGlgnvGKttllnrllggef..depgpTigvnvttf----
00481801   1/1  -------------------------akialvGlpnvGKStllnallgadfaivedt--------------
00481131   1/1  -----------------------lelkvvlvGdpnvGKssLlnrllggkfvsdypgttrdfivktv----
00372481   1/1  ----------------dlslllkrirnvaivGhvdaGKsTLlnaLlgalgaiveagevklalvldsleee
00520981   1/1  ------------------------glkvvlvGdpnvGKstLlnrllggvfvsdypgtt------------
00481541   1/1  --------------------glkkllkvvlvGdpnvGKstLlnrllggvfvsdypgtt------------
00531961   1/1  ----------------------kkllkvvlvGdpnvGKstLlnrllggkfvsdypgtt------------
00442331   1/1  ---------------------kkkllkivlvGdpgvGKstLlnrllgdefvedyagtt------------
00396721   1/1  ----------------------krllnvaivGhvdvGKSTLlnrLlgdsgaiveagtvk-----------
00498681   1/1  -------------------------llkvalvGlpnvGKStllnallgdkfivsnipg------------


                         -         -         +         -         -         -         -:490
query           SNYIGVIHQTPYLFNTTILNNLRIGNEEATIEQVWQVLERVGLKDMVKALPQGLETMVDEAGMRFSGGER
00422801   1/1  kptsGeilldgldilalslaelrrrigyvfqdpalfpltvrenlalglllallllglskaeararalell
00482201   1/1  lrgigyvvqqdallpsltvlenlllgllllgllllllaakeaalralllllllgletlldrlpseLSgGq
00379581   1/1  slaelrrrgigyvfqdpalfpgltvrenlalglllllllllllllllllalskaearervlellelvgld
00530591   1/1  lrgigyvvqqdallpsltvlenlllgllllgllllllaakeaalralllllllgletlldrlpseLSgGq
00509431   1/1  lgslirsgadrasvelvfdlsdglyllerselilrrlilkpgsgeilingkdislldlrelrrligyvpq
00367901   1/1  lllprstvatvelifdllgllliirrlilrdgsgeilidgkdislldlrelrrligyvpqdpalfpqltv
00490801   1/1  GsGKSTLlkllagllkptsGeilidgkditglspqelrrlgglvlqdvllffltll..............
00390411   1/1  asvelvfeldggllallrllslsggeklrvalakallgnpeillngepvnhldlrelllnllrrrgiglv
00510251   1/1  pnGsGKSTLlkllagllkptsGeilidgkditglspqelrrlgglvlqdvllffltll............
00378981   1/1  laelllllrrgigyvfqdpalfpgltvrenlalglllaglskaeaaaraaellell.....glddlldrl
00475891   1/1  llrrgigyvfqdpalfpgltvlenlllgllllglalkeaalra....lllllllgletlldrlvseLSgG
00420701   1/1  laellalrrgigyvfqdpalfpgltvrenlalglllaglskaeararalellell.....glddlldrlv
00482261   1/1  lrgigyvfqqdallpsltvlenlllgllllgellllllaakeaalralllllllgletlldrlpseLSgG
00440861   1/1  pdegvilvggkgvTrdivlytledgvkltliDtpGlgdtklsdeeklilkyleeadlvllviddglteld
00500441   1/1  rrgigyvfqdpalfpgltvlenlllgllllglslaeaaera....lelllllgledlldrlvseLSgGqr
00475991   1/1  lrgigyvfqqdallpsltvlenlllglllagellllllaakeaalralllllllgletlldrlpseLSgG
00466971   1/1  lllllrrgigyvfqdpalfpgltvlenlllgllllglllllaakeaalrlellllllgletlldrlvseL
00425571   1/1  rrrigyvfqdpalfpgltvrenlalgllllglskaeaaaralellell.....glddlldrlvgeLSgGq
00458601   1/1  qelrrlggvvvqevllffltllenlllglallllllvlllllllllllllaakeaalralllllllgled
00502741   1/1  lrgigyvfqqlallpsltvlenlalgllllglskaeaaaraaellell.....gledlldrlpseLSgGq
00379601   1/1  slvirklpkliltledllelenlsfsygg..kealkdlslaiepgelvlivGptGsGKTTllkallgllp
00436071   1/1  .lrrgigyvfqdpalfpgltvlenlalgllllgll.....ealaralellellglgdl...drlvseLSg
00404101   1/1  lrrgigyvfqdpalfpgltvrenlalgll........kaeararalellell..gldelldrlvgeLSgG
00466931   1/1  peellrllrrrigyvfqepalfpgltveenlllglllrlllelllgrlelllllllllellallldllll
00424961   1/1  telleelrrviglvfqdpplfprltvaenialgaeyf....rdegadvllladsllrlagalrevlgrlg
00468691   1/1  pnGaGKttLlkllagllkpdsgeilvdGedlrelre.lrrrigyvfqdpalfpeltvlenlalgallag.
00436511   1/1  gerlrevlelirelelaelrrrigyvfqdpalpallrllalfpaltvaenlrfglglavlllldsatrla
00361211   1/1  erlragigyvfqdlalfpeltvlenlalg.......rarellerlglail.drlpge...........LS
00485451   1/1  igldifrlsarelrkrig.vfqdpallphltvpenldlgllleilervlellelvgldvvlldtyph...
00469451   1/1  sleesleqlrrrigyvfqdpalfp..................aeellelvgledlldrlpge........
00372301   1/1  dgedlr.........igyvfq...........................llervgledlldrlpst.....
00367481   1/1  gilvpgedalll....................................rvdeiltrvglsdlldrgl...
00422141   1/1  earlpqggriqavlppvvvdfrvstlpdigglslvirklreviltledlglsy..gdpealkdlslaipp
00498251   1/1  lrllagllkpgggvvyidgeesldll..rarrlgvvlqelllfpeltveenl..................
00485931   1/1  .rrigavpqlpvlfprltvlenlalg.gadlaeraeellellglegfdvvliDtag..rgrrvgelsggq
00468601   1/1  rlgigavpqdvplfpsltvldnlalar......dlleaakaagydvvlidtaglld..ldrlvgelsggq
00488521   1/1  ..ggkvlyvdqeeslfpltvlenlalgged.....veellerlgl.dlldrlph...........qlsgg
00448931   1/1  reqlgivfqdp...gltvlenlalgeleararellellgledydvvl..........iDtagrlrlpsel
00437981   1/1  ...rrgiglvfqliglfphltvlelvalglggilveevrellkel.......................ls
00422811   1/1  ....................................................................qr
00426051   1/1  glllrdlrrl.iglvfqdpilfpgltvglllffldnidlgllirgdeeleaalelaglprvielllegld
00381441   1/1  gvdltfls...reeigyvfqepallpdltvlenlylglllalllaleegkivildgdreraeellellgl
00503371   1/1  rldgkdlliylsdlirrgagiayveqefdlfdgltvlenvllglgdeliirrrilrdgrseyllnglgvs
00496111   1/1  rerrrrigyvfqepalfpeltvlenlalgll...............................drlpgeld
00500611   1/1  eslrrrrigmvfqelgldpdltv..........arerviellelvgllelldrlpre...........lk
00495371   1/1  pa.rggiglvfqteallppltvrenlealgldlrglldrerviellelvgleelldrlpre.........
00530601   1/1  ----------------------------------------------------------------------
00451571   1/1  reaiglvtqdgelllelidegilvpdeiv.iellrealeelda.d..gvildgfprllgqaelllsggka
00371631   1/1  dvslsvkkpeiigiaGpsGsGKSTlarlLagllapesgglkvlligtDifylpaeqlkrigllfqkglpe
00464791   1/1  rellglllelgvlf...................aaellervglvaa..........tadeppgelsggqr
00532531   1/1  akaigllrrkigyvfq..lfpfltvlenvalgldglvdeedleraenllalvgleeipnrypse......
00368501   1/1  firidgseltek.dyvGesvearlrelfeeaigyvfqdpalfpgtvlenlalgllvseligappgyvggd
00480471   1/1  kdltlvdtpgiargrlklllearraaigivfqdvdllltltvaenlllgldllllellkelkydpvilll
00475371   1/1  .........................rrpsarellgllgell...........gldvlvgarggdlsgglr
00457311   1/1  eelrklrrrigmvfqdpalflnpgltvrenlaeplrllklgkk..llepvglpevldryphe........
00387201   1/1  yelGeilldgrdlyrlsleeallllfldeileidglllvelre---------------------------
00475521   1/1  lrrdigmvfqdpalfplltvrenvilgllelaglskaealarvdellelvglddellldrlp........
00495031   1/1  eltlsperlrlraqsl...............gl.dldellerllvidllelvgllelldrlpre......
00462761   1/1  ..lglliglvfqdpdllpfltvlenvllpllaaglivivdgtlllvglrealrkll..........gl.l
00478411   1/1  ..gigmvfqdpalfplltvrengvalglllaglskaeieervdlllelvglddlldrypd..........
00475381   1/1  lgllreglirigyvfqdyalfprltvlenvllgll.............................llgglv
00414121   1/1  ledlgvlavrlgigyvpqtlglfpaltvlellalall...............................lr
00437941   1/1  ...............................................................pselsgg
00503741   1/1  gllkpkfgeillfg............kvvyvnvselldlkellrll........................
00478441   1/1  grdilmvfqppalfpllevrglniaevlelaglskaealkrvdlvlelvgld..............dryp
00512891   1/1  rrgigyvfq.......tveellgllaelvgle.................vrgeleellktlikelsggek
00515531   1/1  qlwDtgGqerfrslwilyfedadaiifvvdlsdrdsflelrrwigrlfqdlnlfpsltvlenlanvpill
00368571   1/1  la..rglgvvildpgdgrsvrlnplaliddeedaaellralvsemgrgeddfftpaarallralilalae
00515511   1/1  qlwDtgGqerfrslwllyfegadaiifvvdlsdgdsllalrrwigrlfqslnllesllvlenlanvpill
00489571   1/1  ......................................................................
00356411   1/1  wDtgGqesfrklwilyfegadaiifvvdasdrdsflnldkwrnrlgevlqllelilnltvlenvpi...i
00379961   1/1  kdlrellragiplvflnfaalpasllesel........................................
00477971   1/1  dg.vgyvfqsrelfpeltvagnfleg......aevrgnlygtsrerveelleagldvlldidpqglsggq
00484101   1/1  ellgigylfqdvgllpvltvrenlalllrglpgysaeeleralellelagfdvilieGllelalplilel
00379261   1/1  evdaselteggyvgedlekrirelfqearllvfltvlenirldaseylekrvvsrligappgyvgyglgg
00405881   1/1  dpnlgvvelddgrqlvlvDtpGliel.aslgeglvrqalealeradvillvvdasdplldqpvellsgge
00477011   1/1  tpgltvlvvflelgerldl...lglvfqdfsllpelielenralagpiagisrdairleielpglpdltl
00434401   1/1  lllreglgidfqlpdal...............drellreevlellgl...........gevvivdvydls
00490731   1/1  .........................yrpaadellgvlaee...........lgldvllgarggdlsgglr
00404191   1/1  ............................................................delvsklsgg
00487021   1/1  .......gevfqdyalfphltvlelldnvllgleir.gllkaerlervevllervgl..lldrippa...
00533501   1/1  .lgrgigyvfqdpalfpgltvrenlelllvfadrygvlrglikpalaegvsvildrvglsdlay......
00495771   1/1  rhtTrdvllirle.g..lvliDtpGfrdtileniekeeleatfeeireadlvllvid-------------
00499191   1/1  .gllvgvvfqddfylllpalevlengafll.dlllpdaldrelllelllalveglvvlldryprllsggq
00432181   1/1  dgrkl..............................................................vli
00493431   1/1  rg.igyvfqsgalfphliva.....gnllegaevhgllygtskerveealekgllvlldr...dlsggqq
00513761   1/1  ..eqlgidirdlidletvme.lglgpngalvfaleellttldillealelleedydyiliD....tpGgl
00392701   1/1  ........................................................llgkyvgelsgglr
00510561   1/1  l.rarrlgldldrlllldaltv...................................eellalaerllsg
00464411   1/1  lgeligevfqdgilfpdltvlenvalgrygllglikealaegvivildrvglsdlay............p
00444381   1/1  Ttlakalakll..gvpfiridgselte.....kelvGe................................
00496571   1/1  gelir.glvfqdpllldeltvlenlalgrylhl.glilaalaagvgvvldrvglsdlay...........
00532471   1/1  aalldivd....................egrliglvfqdldllpllevlellaarleellerippalsgg
00406781   1/1  ........................................................llgkyvgelsgglr
00439861   1/1  ......................lyisleesreqlleraerlgl.dleellllgllsiliadplglsgeel
00470731   1/1  gagfilidg.........................ddlre.kavgeleklgrdlfqvaregglvpdilfid
00498811   1/1  aggglliglifqdfglfelldrellielllenlalglalegvildalrrrllelldll...........g
00394721   1/1  ...................................................vrldlsellsvsdlvgele
00498531   1/1  rarrlgldldellllpal...................................tveellalaerllsggk
00513251   1/1  ...................................................................gqk
00489631   1/1  dllrellgellgrgigf................gfqqgdlledatvlenlalllldeidkaledggvvll
00420941   1/1  iridg................................................................s
00480441   1/1  vlgvdyvfvdrelfeelivagnlled.....aivhgllygtskerieealdaglgvlldgfprglsqaqa
00468951   1/1  lalqlaanlaklggkvlyid...teesldqlrarrlgldlddllllpaltveellala............
00517691   1/1  ........................................gtlllllgllsfllalvldslplerergit
00386741   1/1  .....................................................................s
00476071   1/1  ......................ggpllerirellgegyllfdealdrellaallfglel.egalldglvy
00482721   1/1  ggtplgerirellgegyllpdealfrallaellfgdllalalldgvv...........ydrlrdellael
00527261   1/1  leellrela..........................eelgellellkkllkklsellglsilglelilgls
00437921   1/1  vddlreligevlqalglllgg.................................................
00508671   1/1  dgddlraglsiglilsdedraalrrrlgevfqelllagrlvvldgtalgl..elrdelrellkeaglpll
00367291   1/1  irvda................................................................s
00409841   1/1  ......................................................................
00480251   1/1  ............................psapeqlgilgellgvpvvgvltgldlagalrealelllleg
00410531   1/1  kl.....................................................viwDtaG.....qer
00478081   1/1  ell.lgldlleilf..............................................eglllsdefr
00410321   1/1  ----------------------------------------------------------------------
00437901   1/1  GvGKTtlakalakel..gapvieidaselrd.......................................
00521551   1/1  rlsas................................................................e
00471271   1/1  ----------------------------------------------------------------------
00533151   1/1  igevfqda.leagl..........llfddefrglller...............leellargpvvildgf.
00401211   1/1  .........................................................ldtlkgelergit
00473941   1/1  ...........................................pfielsasdllg.............es
00461621   1/1  lgklikdyfdpgalvpdllirlllerllfldeg..........ggflldgfprtleqaeals...kpavl
00402371   1/1  .................................................vrldasellefgkyvgafegg
00499331   1/1  gagtdigevfqdlllaggllvddev.......rrlllealdelllaggkvvildgf...........pgg
00487061   1/1  .........................................er.gargldvvviyepvdywaavgggdll
00515351   1/1  ggtdigelfqdyllfpfltvdeni...........rglllealeellaagkvvild............gl
00403151   1/1  dgkklvkltlwDtaGqerfrslre........................lyyrgadgvllvydvtdresfe
00519581   1/1  fgdvgglvvdli...................................................dleaver
00496061   1/1  epggtdlgeifqalllagellfddevlgllrerldelie...........lllagg.vvildgfpldleg
00378621   1/1  ----------------------------------------------------------------------
00478391   1/1  eggrlgrdlfdedrllfrellideidl...........................................
00472911   1/1  pl..........................................................gllfedalea
00469161   1/1  lirelllegfqdlilvpdllvlellaan.............raglrelikellaagkgvildrfplsrla
00509891   1/1  .......................................ldeplgvdrerlrrvgelalllaggglcalv
00470231   1/1  l..............................................................qlwDtaG
00387321   1/1  ----------------------------------------------------------------------
00418301   1/1  firvdaselte.....ael...................................................
00523461   1/1  ----------------------------------------------------------------------
00497571   1/1  rvn...................................................................
00416171   1/1  ..................................................dlleselfghekgafgggek
00511381   1/1  lvvsriglvleavglffaldllelll............................................
00482661   1/1  erlellekiieellrirldklledldeiveelppvlfddlvgqeeakeallenlklflkgpellldlglp
00489391   1/1  ..................................................eavpggtdlgelfqdllleg
00444821   1/1  ----------------------------------------------------------------------
00497591   1/1  ----------------------------------------------------------------------
00526911   1/1  ----------------------------------------------------------------------
00357861   1/1  ----------------------------------------------------------------------
00447401   1/1  ----------------------------------------------------------------------
00457851   1/1  llreavpggtrlgeviqdlfllggllffdeldel................lkerieellaaggvildgfp
00430121   1/1  selig.....................................................hppg..yvGede
00515821   1/1  ----------------------------------------------------------------------
00517931   1/1  ----------------------------------------------------------------------
00378841   1/1  dgkkvklqlwD-----------------------------------------------------------
00465511   1/1  dgkvkltliDt-----------------------------------------------------------
00518311   1/1  ----------------------------------------------------------------------
00514481   1/1  ----------------------------------------------------------------------
00420081   1/1  gsdlleliyqlplrldlgeislddaallllslqllfaapylslnevidaarvlladefikplpagykvvi
00528321   1/1  ----------------------------------------------------------------------
00407471   1/1  ----------------------------------------------------------------------
00516041   1/1  elgriielfdearelvpelallfideidell........................akgkvvild......
00449901   1/1  ----------------------------------------------------------------------
00517041   1/1  ----------------------------------------------------------------------
00519521   1/1  ----------------------------------------------------------------------
00517841   1/1  ----------------------------------------------------------------------
00424711   1/1  ----------------------------------------------------------------------
00528591   1/1  ----------------------------------------------------------------------
00402391   1/1  ----------------------------------------------------------------------
00488191   1/1  ----------------------------------------------------------------------
00518321   1/1  ----------------------------------------------------------------------
00484261   1/1  ----------------------------------------------------------------------
00494041   1/1  ----------------------------------------------------------------------
00481801   1/1  ----------------------------------------------------------------------
00481131   1/1  ----------------------------------------------------------------------
00372481   1/1  rergitidsga-----------------------------------------------------------
00520981   1/1  ----------------------------------------------------------------------
00481541   1/1  ----------------------------------------------------------------------
00531961   1/1  ----------------------------------------------------------------------
00442331   1/1  ----------------------------------------------------------------------
00396721   1/1  ----------------------------------------------------------------------
00498681   1/1  ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:560
query           HRMALARILLKDAPIIILDEPTVGLDPLTEQEVISIFNRELKDKTLIWITHHLQGVEAMDQVIFIEDGTI
00422801   1/1  ellplgldtlldrlvgeLSgGqrqrvalArallldpdllllDEptsgLDpetraellellrelakgltvl
00482201   1/1  rqrvalArallldpkllllDEPtsgLDpetraellellrelakgltvllvthdlsearladrilvlddGr
00379581   1/1  tlldrlvgeLSgGqrqrvalarallldpdllllDEptsgLDpetraellellrelakegltvllvthdld
00530591   1/1  rqrvalArallldpkllllDEPtsgLDpetraellellrelakgltvllvtHdlsealladrilvlddGr
00509431   1/1  dpnllfqltvlenlllgpeerrelldellglellsleealaraeealeelnallkeleeeleligplldg
00367901   1/1  lenlllglelrrklldellgllellalleellklleellkelevleaalaallkeeieeraeellellgl
00490801   1/1  lllaakeaalralllllllgletlldrrpseLSgGqrqRvalArallldpdlllLDEPtsgLDpetrael
00390411   1/1  pqehdlfplltvaenialldelaglpkygnylsllkeklkelnallkelelqlkelarllelleglkeea
00510251   1/1  ..lllaakeaalraellllllgletlldrrpseLSgGqrqRvalArallldpdllllDEPtsgLDpetra
00378981   1/1  vgeLSgGqrqrvalarallldpdllllDEptsgLDpetraellellrelakelgltvllvthdlsealrl
00475891   1/1  qrqrvalarallldpkllllDEPtsgLDpetraellellrelakegltvllvthdldealrladrilvld
00420701   1/1  geLSgGqrqrvalarallldpdllllDEptsgLDpetraellellrelakelgltvllvthdlsealrla
00482261   1/1  qrqrvalArallldpdllllDEPtsgLDpetraellellrelakgltvllvthdlsealladrilvlddG
00440861   1/1  lellkllkelgkpvilvlnkiDllkkeelekllkslnkelglkelrrgigyvfqdpnlfpglvvlisalt
00500441   1/1  qrvalarallldpdllllDEPtsgLDpetraellellrelakelgltvllvthdlsealrladrilvldd
00475991   1/1  qrqrvalArallldpdllllDEPtsgLDpetraellellrelakegltvllvtHdlsealrladrilvld
00466971   1/1  SgGqrqrvalarallldpdllllDEPtsgLDpetraellellrelakegltvllvthdldealrladril
00425571   1/1  rqrvalarallldpdllllDEptsgLDpetraellellrelakelgltvllvthdlsealaladrilvld
00458601   1/1  lldrlpseLSgGqrqrvalArallldpdllllDEPtsgLDpetraellellrelakegltvllvtHdlde
00502741   1/1  rqrvalArallldpdllllDEPtsgLDpetraellellrelakegltvllvthdldealrladrilvldd
00379601   1/1  pdegiitiegpdel.....lrnkigyvfQdpvlfpltvren.............................
00436071   1/1  GqrqrvalarallldpdllllDEptsglDpetralllellrelaeelgltvllvthdldlalaladr---
00404101   1/1  qrqrvalarallllleelsldpdllllDEPtsglDpetraellellrelakegltvllvthdldealrla
00466931   1/1  lllllllllllllllvlllllllllvlllllllalllllalkeaallleelllllglgdlldrpvstLSG
00424961   1/1  relSgGqkqrvaiarallleragnleggGsiTalatvlveggsdpdllllDeptsalDgeivlslllalk
00468691   1/1  ....................lglaeyldelgkdLSgGqrqrvalAr.....pvlLllDEptsgldalre.
00436511   1/1  qakreisalarellervglpgdlftllsrlderagnlSgGqrqrvaiaralasdpdllilD---------
00361211   1/1  gGqqqrvaiaralaldpdllllDeptsalssrssendpetvaellellkelakelgvtvilvthdldlld
00485451   1/1  ........elSgGqrqRvaiaralaldpdvlllDEptsglDpetralelldllrtdldkelgrtiilvth
00469451   1/1  ...lSgGqrq..aiara.ardpdllllDeptsalrgsenDpetraeilrlLkelakelgvtvilvtH...
00372301   1/1  ......lsgGqrqrvai.ralatepsllLlDEptsgldpelraalaeallellaelgatvlfvtHdlela
00367481   1/1  .........slsggerqrvalaralatdpslllLDEptsgldpedgaalaeallellaellgatvlvvtH
00422141   1/1  gglvlltGptGsGKtTllralagllnpdegriltiedp...........ieyvfqspnlfpl........
00498251   1/1  ..................drlprllsggqrqrvvidsalalrpkllllDEPtsgldplsarellellrrl
00485931   1/1  kqrvaiarallllldpelllldEptsglda...lrlllellkel.gltvlvvthddgtakggaalslale
00468601   1/1  kqrvaiarala.apevllldeptsgldalae...llelleel.gltvlvvtKlDgtakgghdlslalrla
00488521   1/1  qrqrvaiaralaeelkpdllvlDeitalfraelegrptsaldvsllrellrlLkrlakelgvtvllvthd
00448931   1/1  sggqkqrvaiaralaaplppevllldeptsglda..lrellellrel..gltvlvvthlDllakggadls
00437981   1/1  gGqkqrvaiaralagdpkvlllDEpt.aldpdaqnaLlklleelakgvtvilathdlsellpallsrcqv
00422811   1/1  arvaaeRi...D.P--------------------------------------------------------
00426051   1/1  tlaggggvvlsGgqrqrvalar.....pdlllfldeptselleRllkrltrpgldadteeellellerla
00381441   1/1  dadlviilpasleellerldrrggelsggqkqRvalaral------------------------------
00503371   1/1  lkeliellldlsggelnrvalllqgevdlllldepterldfldelagleeykgnyeellklleeleellk
00496111   1/1  lSgglqrqrvaia...agdpdllllDeptsalrslgndpelraellrllkrlkelgvtvilvthdleeae
00500611   1/1  rsggqrqrvviDaralllrpel..lDEptsaldvslraeilrlLkrlakelgvtvllvthdlreveelad
00495371   1/1  ..lsggnqrqrvvia.alallpkllllDEptsaldvslraeilrlLkrlakelgvtvllvthdleeveel
00530601   1/1  ----------------------------------------------------------------------
00451571   1/1  dlvifldaplevlleRllkrddekilkrleeqkqrvaiarallkkpailild------------------
00371631   1/1  aldveell......................ellldlkegledilvp....vlsggqkqrlalaralvedp
00464791   1/1  qrlaiAraladdqgkpvllllDEptsgldal..reillllgellseegytvllvshdlslleraadr...
00532531   1/1  .....lsgGqqqrv...........illldEPtsgLdpvsr.........................lela
00368501   1/1  lggllteavlealriklvegelgfrelerevlldlplhdasviallgggrelrdgellkalkeaeaeell
00480471   1/1  nkidllddrllrraeaeerieellel--------------------------------------------
00475371   1/1  qr..larallgdpdvlliDepgrgldpellallaelldllrelradlgllvvdathdldavlkaadrilv
00457311   1/1  ...lsgGqrQRv...ralaldpdllilDeptsalgqpdpelr.elldllifldadlgltlirlitrdlge
00387201   1/1  ----------------------------------------------------------------------
00475521   1/1  ......sggqqqeilrvaiallilpvllgralallpellllde---------------------------
00495031   1/1  .....lsggqrqrvviDalalllrpell..DeptsaldvqlvaeilrlLkrlakelgvtvilvthdlrev
00462761   1/1  sgGqkqrvadlvvlldadpevllaReptrgldpeteeeleellerleereplygadiviithdlsieeva
00478411   1/1  .elsggqrqrvaiaralalepelllldeptsaldplavvellelllglneeldiilal------------
00475381   1/1  vildggvrqrlalarallldpdvllldeplllldaalr..........................dlpdlv
00414121   1/1  edpdlilidsgGqkqrlalaralladpdlgellllDeptlvlDaasgedlldllkelaeqlgltvlivln
00437941   1/1  erqrvliaralladpkvlllDEi.daldpeaqnaLlklleelpkgvtvilttnrleeldpallsRfdvie
00503741   1/1  .......lealglpppyqlsggerlrvalaeallalgkpdllilDEitnlldpetlspdvlelLlrllee
00478441   1/1  yelsggerqrvailr..vllpklllpdepgrnldvlievavlnlilkllgidal----------------
00512891   1/1  qrvalarallakpdvlllDEid.gldpdvleallelleelkrsgvtvilttndldeleladriallrrgr
00515531   1/1  vlnKiDlleakeraeellellglgdlldklpse...........lsg-----------------------
00368571   1/1  epe..ptldellellselg....lrdladrleklvagglagllegaektaasilellr------------
00515511   1/1  vlnKiDlleaklvllllvglfdlldglpse...........lsg--------------------------
00489571   1/1  lallelrntteagaasgsrdkgllgklkpetraelldllre..egttilvvth.ldeaeraDrvavldd.
00356411   1/1  lvlNKiDlleekive...ellellgleykgdrdpee...........lsggq------------------
00379961   1/1  .lsggerqrvalaralalrpGllvlAdggvlllDEp.daldpevqaaLlrlleegevtieragitlllpa
00477971   1/1  kqrlalaralilppsllrgldep.ealdarle.raleellelaegfdvvivnhdleealelldri-----
00484101   1/1  relsdgqiqrvaparallrdpllllldedtvvldkvdlasildlllellee-------------------
00379261   1/1  llteavrrlpysvllldelekahrpirvlllsaslvlllgglglpevgelllellddvgltdllgrtvdf
00405881   1/1  kqrlalarallgkpvilvlNKiDep....tneldlellellee..lggtvvlvSahdgegldelldaile
00477011   1/1  vDtPGlgsvavvdqlsggqkqrvalarallknpdtlillvedandldtesd-------------------
00434401   1/1  ggerqr...aralasgpdvlilDgptlgldv..........lldl.pdlvifvdhdle------------
00490731   1/1  qr..larallgdydvliiDtpgt.ldvllelallellkellaelgadvvllvvdat.lgleaadrilvll
00404191   1/1  lqeqrvaiafalarkpdllllDEidalgldpelqeellelldelaergvtlilttnnrpeeldqall---
00487021   1/1  ........lsgGqgqrvildrallselayqpdvllldeplsgldaklreelrdllrellpegilpdlvif
00533501   1/1  ....dgfprllsgggrqrvalaralvvkpdlvilldeplevldeRlrkrgrlelreldseevlekr----
00495771   1/1  ----------------------------------------------------------------------
00499191   1/1  rqrvaia.....dpdvlildgptllldpe..........................lrpladlvifl.das
00432181   1/1  DtpGleefasggekqrvalalallreadvlllvvdadeptsfldlellellr------------------
00493431   1/1  lrvalaralvvfildpslelldeRlsgrdadtreeirkrlkrlleelgplieydyvivnddleealeell
00513761   1/1  e.lrallalllaiaralaadeillvddptsgldaetqleilelllelllklgipiilvlnKlDllseegl
00392701   1/1  qr..larallakpsvlllDEidklapkrsptsgldvelrrrvlnaLlrlleglrllsgvtviattnrpee
00510561   1/1  gkvdlvviDsltalapalelsllldeptsgldasllreilrllkrlakelgvtvllvshvlkevedladp
00464411   1/1  gf.lsggeqqrvaiarallpkpdlvllldepteeldeRllkRg.rllek..leyikkrlehylelaepyk
00444381   1/1  .....................segailsggfkqrvgia..lladpgilflDE------------------
00496571   1/1  gfprtlsglgqrqrvalarallkpdlvifldeppteeldeRlrkrl.......rlgdteevle-------
00532471   1/1  qgqrvildrslysrpavlllllyvdeplsgldvelreelrdlleslllvlplpdlviyldadpeelleRl
00406781   1/1  qrlalara..adpgvlllDEidalldarsgsgsggdsssrrvlnaLlrlleelrllsgvtviattndlee
00439861   1/1  lrvllalalelkpdlliiDeltalldaervrelrellralkrlakelgvtvilvsqltelildalaggg-
00470731   1/1  eidallrkgpdvildgagrtpeqlealldllee.lgrpvvviilttnrevlldral.rR-----------
00498811   1/1  ldvvilegplllsgglrqrpdlvifldappevlleRllkRggldeetiekrlelylelaplygaadivid
00394721   1/1  gglrgllteala.lakpsvlflDEidrlldardsesslevlnaLlrlledgnvl----------------
00498531   1/1  pdlvviDsltalapslllldepgrvtqgldarllreilrllkrlakelgitvlltshvtrevedraddvp
00513251   1/1  qrvalleaalkegylvvvDet..gldraqrlellelardlgrpvlviflatspevlierlldrvllldeg
00489631   1/1  dgfdrsqlqrlailrallddppdlvvfldapleellerllkRdgrteeeilerlarleeryradlvivtd
00420941   1/1  ellgkyvgelsgglrqllalara..akpsilllDEidklapkrsptsaldadvrrevlnaLlrlldg---
00480441   1/1  lrlaldlvllldpslevlleRllgrgddteevirkrlerlapeleyyeelgladvvivnddleealelll
00468951   1/1  ........................erllsggkpqlvviDsltalrpalllldeptgellgldvrllsell
00517691   1/1  idvalarllldgrkilllDtP..Ghed....................fvkevlralrladgallvvdad-
00386741   1/1  elsggeklrgllarala.kpgvlllDEida.ldpdvqeallelleegeltivgg----------------
00476071   1/1  gvlqdrllerllaagpdvlildgpl.lldvellplpdlvifldappevlleR------------------
00482721   1/1  sggqgdvliiegalllepgllplpdlvifldappevlleRllkRg..gdseeeiekrleryreiapllea
00527261   1/1  ggdleelleelaellkklgkpvililDEiqslldvsskelleaLlrlldegknvtiiltgs---------
00437921   1/1  ...............kpdvlllDEi.drldpdaqnallklleelpagvtliltt----------------
00508671   1/1  vvfldaplevlleR.drrglypeelsgglkqrvaiarpl-------------------------------
00367291   1/1  elle..klvgegegrlrgalaealradpgvlflDEidalagkrgsgtsrldpevqnaLlrlleelrvlsg
00409841   1/1  .......vlldgrdllllDtPGlidfaseptnlldleii-------------------------------
00480251   1/1  ydvvliDtagglqrglllalaladlllvllldepllvldatagtellelakgllealgld----------
00410531   1/1  frsllarylrgadgillvvdatdglsfeevaklleellglaglegvpiilvgnKlDl-------------
00478081   1/1  elleealalladgdvvilDgfgrlldarq...............lleelllllleepppdlvifl.dadp
00410321   1/1  ----------------------------------------------------------------------
00437901   1/1  ....................vddlsgyvgelsggeklrellaealteavlkgkp----------------
00521551   1/1  lvg..kyvgelegglrqllalaraanpgvlflDEidklapkrsptsglddvsrrrvlnaLlrllegledl
00471271   1/1  ----------------------------------------------------------------------
00533151   1/1  ...pggllqrealrrlllrpdlvifldapleelleRllkr..............................
00401211   1/1  ikigaasllldklaivsdtpgt------------------------------------------------
00473941   1/1  dlrggfkqa........akpgvlflDEidrl.drevqnaLlelleelqvtilgg----------------
00461621   1/1  sggrkqrlalaralavdpe.lild----------------------------------------------
00402371   1/1  lrqllglaraa..kpgvlflDEidsllgarggsgvdpevqnaLlrlleeg..nvrviaatnrpelvklge
00499331   1/1  llqrealrrllprpdlvilldappeelleRllkr....................................
00487061   1/1  rlirelllrlgfgepdafdnellgellealleggkivlsarraqlleirlirpllaegkvvilDrepdsa
00515351   1/1  sggllqrvallrallrpdlvif------------------------------------------------
00403151   1/1  nvlswleelrellgllllegvpillvgnKlDlptnerdvsleealelalelgllp---------------
00519581   1/1  hlldiaeellengeilildeptvgldsk...dildelakilkevnfelifithd----------------
00496061   1/1  alllrealarallpdl.vifl-------------------------------------------------
00378621   1/1  ----------------------------------------------------------------------
00478391   1/1  ...........llakgkvvildgtnlsealdealrrllr........................pdl----
00472911   1/1  gfrqrladlirallakgkvvild..gtglsreareellellkelg.pvlvifldadpevlleRllkr...
00469161   1/1  yqlsggerqrlaidlegalllerllldepfpdlvifldaspeelleRllkRgre................
00509891   1/1  addlagaleel.laralaggpdviliE..gagllplpliell....rdlldlvvlvvldgivllvdaidr
00470231   1/1  q.....erfr.sltlryl----------------------------------------------------
00387321   1/1  ----------------------------------------------------------------------
00418301   1/1  ........vGyesgarlrelfaragigllaladpgvlflDEidkllpargssggdvsredvlnaL-----
00523461   1/1  ----------------------------------------------------------------------
00497571   1/1  ...........nlrdlfelar....dpgilflDE.dklapdrqak.....llrvldggvn.tllr-----
00416171   1/1  qrlgllrla..dggvlflDEidkl.....dpdvqnaLlrvleegeltrlgggi...vlpadvrli-----
00511381   1/1  .............qdpdviliDE.aqfldp....evvevlleladtgilvlvtglemdfagelfegsllL
00482661   1/1  kgrgllLyGPpGtGKTtlakalanel...ggpvi.....................---------------
00489391   1/1  ellfideiaelllealaeaegkvvildgtg..ldieqrealrelllelprpdlvifldadpeelleRllk
00444821   1/1  ----------------------------------------------------------------------
00497591   1/1  ----------------------------------------------------------------------
00526911   1/1  ----------------------------------------------------------------------
00357861   1/1  ----------------------------------------------------------------------
00447401   1/1  ----------------------------------------------------------------------
00457851   1/1  ldlegaealreallragplpd-------------------------------------------------
00430121   1/1  lgvlfeaarkappsvlllDEidkl.....dpdvlnaLlqlleege...vtdlggrvvdlsnvivi-----
00515821   1/1  ----------------------------------------------------------------------
00517931   1/1  ----------------------------------------------------------------------
00378841   1/1  ----------------------------------------------------------------------
00465511   1/1  ----------------------------------------------------------------------
00518311   1/1  ----------------------------------------------------------------------
00514481   1/1  ----------------------------------------------------------------------
00420081   1/1  iDRhplsallvFplarylggdlslealnallktle-----------------------------------
00528321   1/1  ----------------------------------------------------------------------
00407471   1/1  ----------------------------------------------------------------------
00516041   1/1  gtgrlleldealellgpdlvifldappeelleRllkrgldee----------------------------
00449901   1/1  ----------------------------------------------------------------------
00517041   1/1  ----------------------------------------------------------------------
00519521   1/1  ----------------------------------------------------------------------
00517841   1/1  ----------------------------------------------------------------------
00424711   1/1  ----------------------------------------------------------------------
00528591   1/1  ----------------------------------------------------------------------
00402391   1/1  ----------------------------------------------------------------------
00488191   1/1  ----------------------------------------------------------------------
00518321   1/1  ----------------------------------------------------------------------
00484261   1/1  ----------------------------------------------------------------------
00494041   1/1  ----------------------------------------------------------------------
00481801   1/1  ----------------------------------------------------------------------
00481131   1/1  ----------------------------------------------------------------------
00372481   1/1  ----------------------------------------------------------------------
00520981   1/1  ----------------------------------------------------------------------
00481541   1/1  ----------------------------------------------------------------------
00531961   1/1  ----------------------------------------------------------------------
00442331   1/1  ----------------------------------------------------------------------
00396721   1/1  ----------------------------------------------------------------------
00498681   1/1  ----------------------------------------------------------------------


                         -         -         -         *         -         -         -:630
query           EMQGSPDYLRKTNERYQKLKAIDEGR--------------------------------------------
00422801   1/1  lvthdlsl--------------------------------------------------------------
00482201   1/1  ivelgtpeellenpgllytllllgee--------------------------------------------
00379581   1/1  ealrladrilvlddGrivelgtpeel--------------------------------------------
00530591   1/1  iveegtpeellenpgllylllleeg---------------------------------------------
00509431   1/1  lellvglnglldrplselSgGe------------------------------------------------
00367901   1/1  gglldrp---------------------------------------------------------------
00490801   1/1  lellrelakegktvllvtHdlse-----------------------------------------------
00390411   1/1  ekak------------------------------------------------------------------
00510251   1/1  ellellrelakegktv------------------------------------------------------
00378981   1/1  adrilvlddGrivelgtpeell------------------------------------------------
00475891   1/1  dGrivelgtpeellenpgllaal-----------------------------------------------
00420701   1/1  drilvlddGrivelgtpeellen-----------------------------------------------
00482261   1/1  rivelgtpeellenpgllytllllssl-------------------------------------------
00440861   1/1  gegldeltvrenlalglrl---------------------------------------------------
00500441   1/1  Grivelgtpeellenpkslytaal----------------------------------------------
00475991   1/1  dGriveegtpeellenpgllaa------------------------------------------------
00466971   1/1  vlddGri---------------------------------------------------------------
00425571   1/1  dGrivelgtpeellenpaslyta-----------------------------------------------
00458601   1/1  alrladrilvlddGri------------------------------------------------------
00502741   1/1  Grivelgtpeellenpgllytllllgs-------------------------------------------
00379601   1/1  ............----------------------------------------------------------
00436071   1/1  ----------------------------------------------------------------------
00404101   1/1  drilvlddGrivelgtpeell-------------------------------------------------
00466931   1/1  Gerqrva---------------------------------------------------------------
00424961   1/1  rlyPaidvl-------------------------------------------------------------
00468691   1/1  .ilellrellk-----------------------------------------------------------
00436511   1/1  ----------------------------------------------------------------------
00361211   1/1  sallrpgkrpllsdl-------------------------------------------------------
00485451   1/1  dlreae----------------------------------------------------------------
00469451   1/1  ...Asdrvlvlrdgriv-----------------------------------------------------
00372301   1/1  alladrvvvlndgr--------------------------------------------------------
00367481   1/1  dlelaalaadrivv--------------------------------------------------------
00422141   1/1  .........-------------------------------------------------------------
00498251   1/1  lrlakelgvtvllvt-------------------------------------------------------
00485931   1/1  ladrilvlgdGeivedgt----------------------------------------------------
00468601   1/1  drilvlgvGeivedgtpfe---------------------------------------------------
00488521   1/1  ldevarladr------------------------------------------------------------
00448931   1/1  laleladrilvlgdGeive---------------------------------------------------
00437981   1/1  irfpplseeelleild------------------------------------------------------
00422811   1/1  ----------------------------------------------------------------------
00426051   1/1  ----------------------------------------------------------------------
00381441   1/1  ----------------------------------------------------------------------
00503371   1/1  elekrlellek-----------------------------------------------------------
00496111   1/1  dladsgri--------------------------------------------------------------
00500611   1/1  krdrvvvlr-------------------------------------------------------------
00495371   1/1  adrvavlag-------------------------------------------------------------
00530601   1/1  ----------------------------------------------------------------------
00451571   1/1  ----------------------------------------------------------------------
00371631   1/1  dvlilDgpta------------------------------------------------------------
00464791   1/1  eggs------------------------------------------------------------------
00532531   1/1  driyvll---------------------------------------------------------------
00368501   1/1  e..llglkdlllrkpsqlSgGqk-----------------------------------------------
00480471   1/1  ----------------------------------------------------------------------
00475371   1/1  ldlggivlnkld..lvakgga-------------------------------------------------
00457311   1/1  agrsadrvl-------------------------------------------------------------
00387201   1/1  ----------------------------------------------------------------------
00475521   1/1  ----------------------------------------------------------------------
00495031   1/1  egrleladr-------------------------------------------------------------
00462761   1/1  drilalleg-------------------------------------------------------------
00478411   1/1  ----------------------------------------------------------------------
00475381   1/1  ifldadpeelleRllkRgr---------------------------------------------------
00414121   1/1  KiDl------------------------------------------------------------------
00437941   1/1  fpppdeeelleilkl-------------------------------------------------------
00503741   1/1  gkltdkllgltliltthdldller----------------------------------------------
00478441   1/1  ----------------------------------------------------------------------
00512891   1/1  ivelgpls--------------------------------------------------------------
00515531   1/1  ----------------------------------------------------------------------
00368571   1/1  ----------------------------------------------------------------------
00515511   1/1  ----------------------------------------------------------------------
00489571   1/1  .....Gtpeellarpanpyvrel-----------------------------------------------
00356411   1/1  ----------------------------------------------------------------------
00379961   1/1  gvtviaatnddlg.....----------------------------------------------------
00477971   1/1  ----------------------------------------------------------------------
00484101   1/1  ----------------------------------------------------------------------
00379261   1/1  kntiiiltsnvge.lsggqrqrv-----------------------------------------------
00405881   1/1  llkgklvlyeg-----------------------------------------------------------
00477011   1/1  ----------------------------------------------------------------------
00434401   1/1  ----------------------------------------------------------------------
00490731   1/1  e---------------------------------------------------------------------
00404191   1/1  ----------------------------------------------------------------------
00487021   1/1  ldadpeelleR....llkR---------------------------------------------------
00533501   1/1  ----------------------------------------------------------------------
00495771   1/1  ----------------------------------------------------------------------
00499191   1/1  pee-------------------------------------------------------------------
00432181   1/1  ----------------------------------------------------------------------
00493431   1/1  diivvlllglilqpgs------------------------------------------------------
00513761   1/1  elvlelleellellpilll---------------------------------------------------
00392701   1/1  ld--------------------------------------------------------------------
00510561   1/1  vpdlrggg--------------------------------------------------------------
00464411   1/1  ddvvvidan..........gsi------------------------------------------------
00444381   1/1  ----------------------------------------------------------------------
00496571   1/1  ----------------------------------------------------------------------
00532471   1/1  lkRgrdpeeqe.rlddleevlek-----------------------------------------------
00406781   1/1  ld--------------------------------------------------------------------
00439861   1/1  ----------------------------------------------------------------------
00470731   1/1  ----------------------------------------------------------------------
00498811   1/1  ndls------------------------------------------------------------------
00394721   1/1  ----------------------------------------------------------------------
00498531   1/1  vlagggvlehladvvlflerdeaykg--------------------------------------------
00513251   1/1  slvdlgvledllasle------------------------------------------------------
00489631   1/1  d---------------------------------------------------------------------
00420941   1/1  ----------------------------------------------------------------------
00480441   1/1  aill------------------------------------------------------------------
00468951   1/1  rllkrlakelgvtvilvshvlkegedra------------------------------------------
00517691   1/1  ----------------------------------------------------------------------
00386741   1/1  ----------------------------------------------------------------------
00476071   1/1  ----------------------------------------------------------------------
00482721   1/1  adlvidndgsle----------------------------------------------------------
00527261   1/1  ----------------------------------------------------------------------
00437921   1/1  ----------------------------------------------------------------------
00508671   1/1  ----------------------------------------------------------------------
00367291   1/1  v---------------------------------------------------------------------
00409841   1/1  ----------------------------------------------------------------------
00480251   1/1  ----------------------------------------------------------------------
00410531   1/1  ----------------------------------------------------------------------
00478081   1/1  evlleRllkRgrrerkddseevlel---------------------------------------------
00410321   1/1  ----------------------------------------------------------------------
00437901   1/1  ----------------------------------------------------------------------
00521551   1/1  s---------------------------------------------------------------------
00471271   1/1  ----------------------------------------------------------------------
00533151   1/1  ....grlirleddseevlekrle-----------------------------------------------
00401211   1/1  ----------------------------------------------------------------------
00473941   1/1  ----------------------------------------------------------------------
00461621   1/1  ----------------------------------------------------------------------
00402371   1/1  ldpallrRfdvielp-------------------------------------------------------
00499331   1/1  ...grldgreddslellek---------------------------------------------------
00487061   1/1  dlafagagyllggldleevkaleell..------------------------------------------
00515351   1/1  ----------------------------------------------------------------------
00403151   1/1  ----------------------------------------------------------------------
00519581   1/1  ----------------------------------------------------------------------
00496061   1/1  ----------------------------------------------------------------------
00378621   1/1  ----------------------------------------------------------------------
00478391   1/1  ----------------------------------------------------------------------
00472911   1/1  grallreevldrllev------------------------------------------------------
00469161   1/1  ............ergrdld---------------------------------------------------
00509891   1/1  ----------------------------------------------------------------------
00470231   1/1  ----------------------------------------------------------------------
00387321   1/1  ----------------------------------------------------------------------
00418301   1/1  ----------------------------------------------------------------------
00523461   1/1  ----------------------------------------------------------------------
00497571   1/1  ----------------------------------------------------------------------
00416171   1/1  ----------------------------------------------------------------------
00511381   1/1  lal-------------------------------------------------------------------
00482661   1/1  ----------------------------------------------------------------------
00489391   1/1  rglrpe..regdseevlekrler-----------------------------------------------
00444821   1/1  ----------------------------------------------------------------------
00497591   1/1  ----------------------------------------------------------------------
00526911   1/1  ----------------------------------------------------------------------
00357861   1/1  ----------------------------------------------------------------------
00447401   1/1  ----------------------------------------------------------------------
00457851   1/1  ----------------------------------------------------------------------
00430121   1/1  ----------------------------------------------------------------------
00515821   1/1  ----------------------------------------------------------------------
00517931   1/1  ----------------------------------------------------------------------
00378841   1/1  ----------------------------------------------------------------------
00465511   1/1  ----------------------------------------------------------------------
00518311   1/1  ----------------------------------------------------------------------
00514481   1/1  ----------------------------------------------------------------------
00420081   1/1  ----------------------------------------------------------------------
00528321   1/1  ----------------------------------------------------------------------
00407471   1/1  ----------------------------------------------------------------------
00516041   1/1  ----------------------------------------------------------------------
00449901   1/1  ----------------------------------------------------------------------
00517041   1/1  ----------------------------------------------------------------------
00519521   1/1  ----------------------------------------------------------------------
00517841   1/1  ----------------------------------------------------------------------
00424711   1/1  ----------------------------------------------------------------------
00528591   1/1  ----------------------------------------------------------------------
00402391   1/1  ----------------------------------------------------------------------
00488191   1/1  ----------------------------------------------------------------------
00518321   1/1  ----------------------------------------------------------------------
00484261   1/1  ----------------------------------------------------------------------
00494041   1/1  ----------------------------------------------------------------------
00481801   1/1  ----------------------------------------------------------------------
00481131   1/1  ----------------------------------------------------------------------
00372481   1/1  ----------------------------------------------------------------------
00520981   1/1  ----------------------------------------------------------------------
00481541   1/1  ----------------------------------------------------------------------
00531961   1/1  ----------------------------------------------------------------------
00442331   1/1  ----------------------------------------------------------------------
00396721   1/1  ----------------------------------------------------------------------
00498681   1/1  ----------------------------------------------------------------------