[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for lsal0:ABD99842.1


[Show Plain Result]

## Summary of Sequence Search
   1::323
  27::76   2.5e-05 37.5% 0036696 00366961 1/1   domain                                  
  28::73   0.00034 42.2% 0051227 00512271 1/1   domain                                  
   1::323


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MKLNKTLLSLTAATGIIATGAAANGAKADKITVKSSDTVSQLALDHATTVDNVQQLNNLENVDLIFVGQT
00366961   1/1  --------------------------slltytVksgdtlssIarrygvsvsellklNgl..pdlllpgqv
00512271   1/1  ---------------------------lltytVksgdtlssiarkygvsveellklNgl.npdlllvGqv


                         -         -         *         -         -         -         -:140
query           LEMGDGSYTTTTYQTASQYQQNYAQNTDAQANYTQTDYSAAQNNVPAATDQVQDTTTTVDQTATPADTTT
00366961   1/1  llipvg----------------------------------------------------------------
00512271   1/1  Lli-------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           QDAQTNVASDTTTSEVQVDATNTDQAATTTNDAVSTGATTTQAQAEVQAPATTTYVENTPAEAPTTTWTD
00366961   1/1  ----------------------------------------------------------------------
00512271   1/1  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           TTSSVNNTVANTNSNYSSASTTPAATTTATQNTTTSSTSSDEDAAREWIANKESGGSYTAKNGIYYGKYQ
00366961   1/1  ----------------------------------------------------------------------
00512271   1/1  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           LTATYLNGDYSAENQEKVANEYVASRYGSWTAAKAHWEANNWY---------------------------
00366961   1/1  ----------------------------------------------------------------------
00512271   1/1  ----------------------------------------------------------------------