[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for lsal0:ABD99890.1


[Show Plain Result]

## Summary of Sequence Search
   1::183
   2::185  1.4e-70 54.6% 0040572 00405721 1/1   lycosylase                              
   3::89     8e-08 23.0% 0042464 00424641 1/1   lycosylase                              
   1::183


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MKCAWIYGADQLMIDYHDKEWGRPLHDERGLFELLCLEGLQAGLSWKIVLNKRKFLREAFDNFEVEKISQ
00405721   1/1  -rCswat.sdplyvaYhdeeWGvPvlddrrlfellvlegfqaGlsWltvlkkreafreaFlgFdpekvaa
00424641   1/1  --lmrlalldpllarllelygdlpwlpaedpfelLvsvilsqqtsdkvvnkalenLfeafllelydfptp


                         -         -         *         -         -         -         -:140
query           YTLDDVEKLLTDPRIIRNRRKIEAIINNAKIVNALHERNESLDSFFWGIINNQPIINNFKNPEEIPTKTK
00405721   1/1  ldeedverlladagiirnrlkieavinnArailelqeefgsfseflwsfvngkpilnslkslsevpaktp
00424641   1/1  ealaaadeeeLeelirglG---------------------------------------------------


                         +         -         -         -         -         *         -:210
query           LSEQISKTLKKMGFKFVGPTIVYSFMEASGMVNDHLVGCYGRN---------------------------
00405721   1/1  lsealskdLkkrgfkfvGptivyaflqavGlvndhlvdclraaev-------------------------
00424641   1/1  ----------------------------------------------------------------------