[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for lsal0:ABD99944.1


[Show Plain Result]

## Summary of Sequence Search
   1::170
   2::161  2.2e-36 34.8% 0041137 00411371 1/1   /beta knot                              
   3::170  3.3e-36 30.6% 0044596 00445961 1/1   /beta knot                              
   3::154  1.2e-32 29.9% 0038338 00383381 1/1   /beta knot                              
   3::155  2.6e-31 32.2% 0047409 00474091 1/1   /beta knot                              
   1::170


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MANHIVLFEPLMPANTGNIARTCAGTNTELHLIEPLGFSTDDKYMKRAGLDYWDKVKITYHPNLPAFLET
00411371   1/1  -dllvvlvepedpgNlGaiiRtaaafgvdlvllvplgfdlldkkllraalgalellplarvtnladllea
00445961   1/1  --qgvvalvrllrilslldlrklplvvvldnvqdpgNlGaiiRtaaafgvdglilvgpraf...npkvlr
00383381   1/1  --lllrlldllelldlrkldlvvvldnvqdpgNlGailRtaaafgvdlvilvglradlldkkvlraalga
00474091   1/1  --llellelrksplllvldnvedpgNlGailRtaaafgvd.alilplgrdlldpkvlraalgalellpva


                         -         -         *         -         -         -         -:140
query           IPENGELYIVSKFASKAYTEADYTNTEKEHYFLFGKETTGLPEMFMRQNPEKCIRIPQNDEHIRALNLSN
00411371   1/1  lkdaglliltta.gsvsltdvdl...ggpvalvfGnEgtGlseellelleadllvrIPmlgl.vrSLNva
00445961   1/1  aalgalellplvvvddlaealedlkeagylvvattlregsvplteldl...pgpvalvfGnEgtGlseel
00383381   1/1  lellplvvvdnlaealellkeagllvvattlegsvllldvdlp...gpvalvlGnEgaGlseellela.d
00474091   1/1  rv.nlaealellkeagllvvattlegsvllldvdlpe...pvalvlGnEgkGlseellel.adllvrIPm


                         +         -         -         -         -         *         -:210
query           TAAIVVYEALRQQGFPNLETTHTYENDKLK----------------------------------------
00411371   1/1  vAaaillyealrqlllaglle-------------------------------------------------
00445961   1/1  lela.dllvrIPmlgl.veSLNvsvAaail----------------------------------------
00383381   1/1  llvrIPmlgl.veS--------------------------------------------------------
00474091   1/1  lg.lveSLNvsvAaa-------------------------------------------------------