[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for lsal0:ABE00014.1


[Show Plain Result]

## Summary of Sequence Search
   1::228
  90::228  1.4e-13 27.7% 0041991 00419911 1/1   e-like                                  
  90::229  1.9e-12 24.2% 0038588 00385881 1/1   e-like                                  
  77::228  6.4e-12 25.0% 0050136 00501361 1/1   e-like                                  
  90::226  6.6e-12 21.4% 0038017 00380171 1/1   e-like                                  
  93::228  1.2e-11 25.6% 0050151 00501511 1/1   e-like                                  
  87::229  1.5e-11 25.2% 0048249 00482491 1/1   e-like                                  
  91::228  2.5e-11 24.2% 0044334 00443341 1/1   e-like                                  
  88::226  2.9e-11 20.3% 0051301 00513011 1/1   e-like                                  
  57::229  3.1e-11 23.4% 0035791 00357911 1/1   e-like                                  
  58::227  3.5e-11 20.8% 0036900 00369001 1/1   e-like                                  
  93::228  6.2e-11 20.2% 0034851 00348511 1/1   e-like                                  
  68::228  1.2e-10 31.0% 0041489 00414891 1/1   e-like                                  
  53::228  1.7e-10 21.5% 0041997 00419971 1/1   e-like                                  
  69::230  2.6e-10 22.1% 0040356 00403561 1/1   e-like                                  
  59::228  4.4e-10 23.7% 0046909 00469091 1/1   e-like                                  
  93::226  7.9e-09 22.0% 0050349 00503491 1/1   e-like                                  
  66::228  1.9e-08 18.7% 0042536 00425361 1/1   e-like                                  
  62::226  4.4e-08 25.5% 0041687 00416871 1/1   e-like                                  
  88::229  5.1e-08 19.2% 0048678 00486781 1/1   e-like                                  
 126::227  2.4e-07 29.4% 0046852 00468521 1/1   e-like                                  
  76::229  2.5e-07 23.0% 0048919 00489191 1/1   e-like                                  
  58::227    3e-07 19.0% 0036560 00365601 1/1   e-like                                  
 194::228  2.1e-06 45.7% 0046155 00461551 1/1   e-like                                  
  60::226  2.8e-06 21.6% 0051163 00511631 1/1   e-like                                  
 126::228  7.8e-06 27.2% 0041576 00415761 1/1   e-like                                  
 194::226  8.6e-06 45.5% 0048493 00484931 1/1   e-like                                  
 194::229  1.4e-05 41.7% 0047030 00470301 1/1   e-like                                  
 194::226  3.4e-05 42.4% 0047309 00473091 1/1   e-like                                  
 194::226  4.5e-05 45.5% 0050105 00501051 1/1   e-like                                  
  89::226  0.00011 21.4% 0050435 00504351 1/1   e-like                                  
 119::227  0.00017 21.6% 0052114 00521141 1/1   e-like                                  
 172::226  0.00017 40.0% 0051755 00517551 1/1   e-like                                  
   1::228


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MNCLLCNNTIDFKLNIKWILSLEKYKRDNVCKRCREELGKCKIDNACEGCGREQKKLLLCNDCIKWKNNN
00419911   1/1  ----------------------------------------------------------------------
00385881   1/1  ----------------------------------------------------------------------
00501361   1/1  ----------------------------------------------------------------------
00380171   1/1  ----------------------------------------------------------------------
00501511   1/1  ----------------------------------------------------------------------
00482491   1/1  ----------------------------------------------------------------------
00443341   1/1  ----------------------------------------------------------------------
00513011   1/1  ----------------------------------------------------------------------
00357911   1/1  --------------------------------------------------------dlhagqilgf....
00369001   1/1  ---------------------------------------------------------kacafe.......
00348511   1/1  ----------------------------------------------------------------------
00414891   1/1  -------------------------------------------------------------------dii
00419971   1/1  ----------------------------------------------------epitakllaellleagal
00403561   1/1  --------------------------------------------------------------------dl
00469091   1/1  ----------------------------------------------------------lvaelllellad
00503491   1/1  ----------------------------------------------------------------------
00425361   1/1  -----------------------------------------------------------------ydrll
00416871   1/1  -------------------------------------------------------------lvaklllda
00486781   1/1  ----------------------------------------------------------------------
00468521   1/1  ----------------------------------------------------------------------
00489191   1/1  ----------------------------------------------------------------------
00365601   1/1  ---------------------------------------------------------lrepitaklvadl
00461551   1/1  ----------------------------------------------------------------------
00511631   1/1  -----------------------------------------------------------lkellelirei
00415761   1/1  ----------------------------------------------------------------------
00484931   1/1  ----------------------------------------------------------------------
00470301   1/1  ----------------------------------------------------------------------
00473091   1/1  ----------------------------------------------------------------------
00501051   1/1  ----------------------------------------------------------------------
00504351   1/1  ----------------------------------------------------------------------
00521141   1/1  ----------------------------------------------------------------------
00517551   1/1  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           KILLNNKSIYTYDNLIIKKYFERYKFMGDYYWRKIFNIEFKNFITNNYPSKDWIYIPIPVDEYTMQHRGF
00419911   1/1  -------------------rvltldlllkqirffldspvdgllyiditkllldpellrelarllaeelae
00385881   1/1  -------------------yldffkllvdpeliralarllaeeilelyggepdvvvgvpr.......gGv
00501361   1/1  ------elleldllkfgdfvltyg.lhsdsyidffkvlvdpellrrlarllaerlkd....didvvvgvp
00380171   1/1  -------------------Yfdiqgllidpedilaaiellaeeiaeklkgglepdvvvgvp.......rg
00501511   1/1  ----------------------ifkllvdpelilrlgrllaeei...kdlkpdvvvgvp.......rgGf
00482491   1/1  ----------------cavipylgyarqdrcakclehplaklklrflldsgkpsiifidllkllgdpell
00443341   1/1  --------------------gaqsdiffdgelvrdlarllaeeiaerlkgldpdvvvgip.......rgG
00513011   1/1  -----------------lhyfdiqklllspedileairllaeeiaedlggkpdvvvgvl.......rgGv
00357911   1/1  .......fdfpldslcispyyyddrpdllldpeliyelvrrlaeelaeklggkpdvvvgvp.......rg
00369001   1/1  .........llyydlpdsqiigffkydvdpllgrllaeelaerlkd...ldidvvvgvp.......rgGi
00348511   1/1  ----------------------fsdilldgllirdlarlladeiaerlkglkpdvvvgil.......rgG
00414891   1/1  pllldyevirelgrllaeeiaerlk.......................glkpdvvvgip.......rgGf
00419971   1/1  rvge.....fdlhsgqispiffdikvlldpellralgrllaeli.relgldidvvvgvpl.......gGi
00403561   1/1  llelladriltvglf.gkpgflyidilkllgdpellrlladllaerlkdldidvvvgipr.......gGf
00469091   1/1  riltvglfplksg.....lyfditkllldpelllelarllaeeiaellpgldidvvvgier.......gG
00503491   1/1  ----------------------rpdvlldgedirelgrllarelaedlalllveveglkpdvvvgip...
00425361   1/1  dvllseeqiqgfidiladelaedyllldy..................iglepdvvvgvl.......rgGv
00416871   1/1  galkfgi..ftlpsgpisgifvdllkllvdpellrrlaeelaeri...agldidvvvgvp.......rgG
00486781   1/1  -----------------Pkpyiafrdilldlleirealrrlaellaerlkglelldlgkpdvv.vgil..
00468521   1/1  -------------------------------------------------------Pylgyarqdrkclpg
00489191   1/1  -----taviPylgyarqdrkllpleaisaklvgrfildsgkksiifvdlrkllsdpellllladllaeli
00365601   1/1  llragadflipg...dlhvdisdlllswevikalire..laeeiaedykdgvepdvivgvl.......rg
00461551   1/1  ----------------------------------------------------------------------
00511631   1/1  galpkggfllfidilsllldpellrllgellaerlaglkidvvvgvea...................gGi
00415761   1/1  -------------------------------------------------------ltllldpeqiqalid
00484931   1/1  ----------------------------------------------------------------------
00470301   1/1  ----------------------------------------------------------------------
00473091   1/1  ----------------------------------------------------------------------
00501051   1/1  ----------------------------------------------------------------------
00504351   1/1  ------------------llFedrpiaaklladlLeaagadrvltldlhrggvpvaaeiagfldipldll
00521141   1/1  ------------------------------------------------dlendvvvgpd.......rggv
00517551   1/1  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           NQVEGLIGDLPYSRVLKMKKLKRDKKQSEKSRSERLKTQQPFEYIGDKLQGNYVIIDDVYTTGRTLYYAQ
00419911   1/1  llpleidvvvgip.......rgGfplaaalaralgvplvlvrkrrk..lpgttlsreerlenlkvalels
00385881   1/1  plaaalaralgvplvivrkrrksygd...terrgnvkilkdl..pgdvegkrVllVDDvidTGgTlraaa
00501361   1/1  l.......gGfplaaalaralglplvivrkrrkyvlpgfiglssysrdygvggalellkgllgdvegkrV
00380171   1/1  Gvplaaalaralgvplaivrkrrksyggtfslsgeleilldlrg....dvkgkrVllVDDvidtGgTlra
00501511   1/1  plaaalaralgiplvivlkrrkytgetlelggvvllln.....ldgdvkgkrvllVDDvidTGgTlraaa
00482491   1/1  ealadllaelikel.lldidvvvgvpl.......rGfplaaalalrlglplvivrkkrklpgtrvtiegl
00443341   1/1  vplaaalaralglplvivrkvgklgrtryrdeqkelslgerlkllrlpadlkgk...rVllVDDvidTGg
00513011   1/1  plaaalaralglplavgfkrrksygddlstlgeverlkdlpg....dvegkdVllVDDvidTGgTlraaa
00357911   1/1  Gvplaaalaralgvplvivrkrrklpvd.flsvssyvgrtliegnvilrlrldgdvkGkrVllVDDvidT
00369001   1/1  plaaalaralgvplvivrkrrkyygrtqiglgreerekgvrlkllpldadvkgkrVllVDDviatGgTlr
00348511   1/1  vplaaalaralgvplvivrkvgklgvtsytddqyalergegnliigfdlpgdvkgkrVllVDDviaTGgT
00414891   1/1  plaaalaralglplggklpvgfvrkeryl..egglsrlerlknvlgafklpadlkgkrVllVDDvitTGg
00419971   1/1  plaaalaralglplnrgvpfvfirkerk..............eygevvlliglvkgkrVllVDDvittGg
00403561   1/1  plaaalaralgvplvivrkkrklpvqvillsyeleygldvafelklpadvkgkrVllvDDvlaTGgTlla
00469091   1/1  iplaaalaralgvplvlvrkkgklh..gttlsveyrlenvegalklpkdalvkgkrVllVDDvlaTGgTl
00503491   1/1  ....rgGvplaaalaralglplvlvrklgvlgitfyrdeqkllgrgavleglklpfdvegkrVllVDDvl
00425361   1/1  vfaadlaralgllglplpldfidksryggdtsslgnvvivkdlig....dvegkhVllVDDiidtGgTlr
00416871   1/1  iplaaalaralgvplvivrkkaklpgddtlsvgyvlerstgvleillilgalvegkrVllVDDviatGgT
00486781   1/1  ...rgGvplaaalaralgllgvpvplgfllvssyrdet...relgvvrlleglpadvkgk...rVllVDD
00468521   1/1  episaklvalllylagldrlltsdkhsgqlqlalisaeeileairelaeeieddigpkplvvvgilrgGf
00489191   1/1  kelllkidvvvgvel...................gGiplAaalalrlglplvivrkrrklpgttvviell
00365601   1/1  Glpfaallarelgvplavdrkrvksygg...trstgelkilkdld..gdlegkkVLiVDDiidtGgTlla
00461551   1/1  -----------------------------------------------------llVDDvidTGgTlaaaa
00511631   1/1  plaaalaralgvplvfvrkegklhgegrtiegsvysrleygvdllllsldallkgkrVlivDDvlatGgT
00415761   1/1  elaeklkelykidvvvgvlrgGlplaaalaralgvplvivrkvgkyp...........etgnvklvldld
00484931   1/1  -----------------------------------------------------llvDDviaTGgTllaai
00470301   1/1  -----------------------------------------------------llVDDvittGtTlraaa
00473091   1/1  -----------------------------------------------------llvDDvlaTGgTllaai
00501051   1/1  -----------------------------------------------------llvDDvlaTGgTllaaa
00504351   1/1  larkilapyldelvlvaialggvvv......lspdlggvlrageldiv..lyrdyaeldkrrplvrevrl
00521141   1/1  praaaladalglplavvlkrrkragvvpilragllrldgvllllsylrelerlgnveellrlvgdvkgrt
00517551   1/1  -------------------------------rkerkghgeveliegalvkgkrVlivDDvitTGgTllaa


                         -         -         -         +         -         -         -:280
query           ELLLKNGASRVCSVTLAR----------------------------------------------------
00419911   1/1  lgadvegkrVllVDDvla----------------------------------------------------
00385881   1/1  elLkeagakvvgvavlvdk---------------------------------------------------
00501361   1/1  llVDDvittGgTlraaae----------------------------------------------------
00380171   1/1  aaelLkeagakvvgva------------------------------------------------------
00501511   1/1  elLkeagakvvkvavlvd----------------------------------------------------
00482491   1/1  ylselergpnllllklpal---------------------------------------------------
00443341   1/1  TlraaielLreaGrakvv----------------------------------------------------
00513011   1/1  eaLkeagaksvkvavl------------------------------------------------------
00357911   1/1  GgTlraaaelLreaGakvv---------------------------------------------------
00369001   1/1  aaielLreaGAkvvgva-----------------------------------------------------
00348511   1/1  lraaidlLkeagrakvvg----------------------------------------------------
00414891   1/1  TlraaielLreaGrakvv----------------------------------------------------
00419971   1/1  TlraaaelLreaGakvvg----------------------------------------------------
00403561   1/1  aielLkeaGakvvgvavlad--------------------------------------------------
00469091   1/1  laaaellkeaGakvvgva----------------------------------------------------
00503491   1/1  tTGgTlraaidaLrea------------------------------------------------------
00425361   1/1  aaaelLkeagaksvkvav----------------------------------------------------
00416871   1/1  lraaielLreaGakvv------------------------------------------------------
00486781   1/1  viaTGgTlraaielLreaG---------------------------------------------------
00468521   1/1  nfaallaralglpliii-----------------------------------------------------
00489191   1/1  yryeleygavtlelklgal---------------------------------------------------
00365601   1/1  aaelLkeagaksvkvav-----------------------------------------------------
00461551   1/1  elLkkagaksvkvavlld----------------------------------------------------
00511631   1/1  llaaiellkeaGakvv------------------------------------------------------
00415761   1/1  advegkrvliVDDiidTG----------------------------------------------------
00484931   1/1  elLkeaGakvvivavl------------------------------------------------------
00470301   1/1  eaLreaGAkevhvavlvpr---------------------------------------------------
00473091   1/1  eaLkeaGakvvgvavl------------------------------------------------------
00501051   1/1  elLkeaGakvvivavl------------------------------------------------------
00504351   1/1  pgdvegktV....llV------------------------------------------------------
00521141   1/1  VllVDDiidtGgTliaa-----------------------------------------------------
00517551   1/1  aellkeaGaevvgvav------------------------------------------------------