[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for lsal0:ABE00071.1


[Show Plain Result]

## Summary of Sequence Search
   1::264
   1::161  1.1e-34 38.8% 0051797 00517971 1/1   )-binding Rossmann-fold domains         
   1::160  2.9e-33 36.2% 0050910 00509101 1/1   )-binding Rossmann-fold domains         
 160::266  1.4e-27 41.1% 0050909 00509091 1/1   sphogluconate dehydrogenase C-terminal  
 162::265    2e-27 41.3% 0051796 00517961 1/1   sphogluconate dehydrogenase C-terminal  
   1::180  8.6e-24 27.5% 0042866 00428661 1/1   )-binding Rossmann-fold domains         
   1::161  2.1e-23 26.9% 0050269 00502691 1/1   )-binding Rossmann-fold domains         
   1::194  5.4e-18 28.0% 0047550 00475501 1/1   )-binding Rossmann-fold domains         
   1::174  3.2e-17 26.4% 0048755 00487551 1/1   )-binding Rossmann-fold domains         
   1::156  1.2e-16 24.2% 0052837 00528371 1/1   )-binding Rossmann-fold domains         
   1::159  1.1e-15 29.8% 0051873 00518731 1/1   )-binding Rossmann-fold domains         
   1::161  4.8e-15 25.5% 0052329 00523291 1/1   )-binding Rossmann-fold domains         
   1::154  1.1e-13 21.8% 0048416 00484161 1/1   )-binding Rossmann-fold domains         
   1::134  3.8e-10 16.3% 0047032 00470321 1/1   )-binding Rossmann-fold domains         
   1::163    2e-09 23.7% 0050443 00504431 1/1   )-binding Rossmann-fold domains         
   1::156  4.3e-09 21.6% 0048102 00481021 1/1   )-binding Rossmann-fold domains         
   1::183  9.8e-09 18.9% 0048454 00484541 1/1   )-binding Rossmann-fold domains         
   1::84   1.5e-08 30.0% 0047294 00472941 1/1   )-binding Rossmann-fold domains         
   2::126  6.8e-08 28.2% 0051235 00512351 1/1   )-binding Rossmann-fold domains         
   1::130  2.7e-07 25.0% 0047516 00475161 1/1   )-binding Rossmann-fold domains         
   1::157  3.2e-07 24.2% 0035535 00355351 1/1   )-binding Rossmann-fold domains         
   1::80   3.8e-06 17.7% 0044044 00440441 1/1   )-binding Rossmann-fold domains         
   1::79     6e-06 18.2% 0050938 00509381 1/1   )-binding Rossmann-fold domains         
   1::108  6.8e-06 23.8% 0042180 00421801 1/1   )-binding Rossmann-fold domains         
   1::156  1.4e-05 22.7% 0046357 00463571 1/1   )-binding Rossmann-fold domains         
   1::69   1.8e-05 36.4% 0048757 00487571 1/1   )-binding Rossmann-fold domains         
   1::129  5.3e-05 22.7% 0045243 00452431 1/1   )-binding Rossmann-fold domains         
   1::83   6.8e-05 18.3% 0050914 00509141 1/1   )-binding Rossmann-fold domains         
   1::75   0.00014 21.6% 0051285 00512851 1/1   )-binding Rossmann-fold domains         
   1::98   0.00023 27.1% 0049730 00497301 1/1   )-binding Rossmann-fold domains         
   1::108  0.00061 19.8% 0042534 00425341 1/1   )-binding Rossmann-fold domains         
   1::115  0.00073 21.3% 0047510 00475101 1/1   )-binding Rossmann-fold domains         
   2::79   0.00076 16.9% 0051575 00515751 1/1   )-binding Rossmann-fold domains         
   1::115  0.00087 19.3% 0036785 00367851 1/1   )-binding Rossmann-fold domains         
   1::264


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MKIGFIGVGNMAKAIIEGLMSKGVEAKNIFIHSAHKSNYEVYSQETGVSACESNSEVIEKSDVVFLAVKP
00517971   1/1  mkigiiGaGnmGsalakgllkagh...evvvadrspekaeelaeelgvtaatsleelledaDvvilavpp
00509101   1/1  mkigiiGaGnmGralaagLlkaGh..sevtvanrtpekaealaeeggv.vaaslaealadadvvilavkp
00509091   1/1  ----------------------------------------------------------------------
00517961   1/1  ----------------------------------------------------------------------
00428661   1/1  mfltlnvrelliklkllrlggleellvlalvyydddadlellkgkkiaviGyGsmGlaiAlnLrdsgl..
00502691   1/1  kkvgiiGlGlmGlalarnlaaaGy...eVvvydrspeklealaal.gaevaaslaealadadvvilavpl
00475501   1/1  MkiaiiGGtGniGsalAlrLaaaG...heVvvvsrspekaealaeeglnllylpgvtaa.dlaeaaegaD
00487551   1/1  mmkigviGlGlmGlplalnlakagh...eVvvydrnpekvealkelgapilelknltaatsleelvellk
00528371   1/1  mkkvgiiGlGlmGlslalalaraGf.adeVvgydrnpeklekalelgatdliaatdlaealkdaDvvila
00518731   1/1  mkiaviGaGnyrlyaaagitnfaraaevaeevgkpeialthstitlgaelkelalgldevvlgepvfmGs
00523291   1/1  kkvgviGlGlmGlalalnlak.gf...evvvydrtpekaealaelgav..aaslaealaeadvvilavpa
00484161   1/1  DgiGfvellregldlkgkkvlviGaGgaaravaaallelga..kkitivnrtlekaealaeefgvla..t
00470321   1/1  llGdntdglgavellerlggdlkgktvlviGaGgiGravaralaaaGa..krvvvanrtpekaeelaeel
00504431   1/1  lmeikkvaviGaGlmGlgiAavlaraGl...eVvlvdinpealeraldeiaklllklvlkgllvelllga
00481021   1/1  lllmlkmmkiaviGaGavGtalAallaengh...eVtlwdrneekvellnekgenpiylpglelpenlta
00484541   1/1  mmkklkvaiiGaGniGlalarallalag.gaevvavadrdpekaglalakelgatttvnavddleellad
00472941   1/1  mkiGliGfGevgqalasdlrergvev..laalklrsedlrelaaelgvelvss..elvlesdlvlsavta
00512351   1/1  -pkkiaviGasddpgklgravarnllelgy...evvpvnpk......gaevlgvkvyaslaelpedvDlv
00475161   1/1  hgkkvgiiGlGniGkavakllkgfgmevlaydrrpke............gavyvsldellaesDvvvlca
00355351   1/1  GkkvaviGlGsmGlalAallaaaGh...eVlvwdrdpekveelaelgapvakylpglellgrlrattdle
00440441   1/1  plrigivGlGrigqkahlpalaalpg.velvavvdrdpekaealaellgvpvydsldelladvdaViiat
00509381   1/1  tlkvgiiGlGnigralhlrallklp.gvelv.vadrdperaeklakklgipkvyddleelldpdiDaVii
00421801   1/1  DgigavsllkrllvdlpgkkvlvlGaGgiGralalalaaaga...evvvvnrtlekaeelaeelgaqgdv
00463571   1/1  mKiaviGaGyvGlelAavla.lgheVtlvdinpeklealnegllpilelgldelveell..gnltattdl
00487571   1/1  llmkigfiGlGvmGlnlalnllkagf...evtvynrtaekaeelvaegalelkllgalvaeslvealek-
00452431   1/1  tisvaelalalllalarnlpgaapllragiwrasdllglelkgktvgviGlGriGlalarllaalGa...
00509141   1/1  nkkkrvaiiGaGriGsalaralleap.gfevvgvfdvdpekvgraieglpvlgvddleelleggvdvvil
00512851   1/1  kirvgiiGlgnigrahlrallklp.gvelvavvdrdpekaedfaeklgipkgvkvyddleellkdpdiDa
00497301   1/1  lkiavlGaGswGtaLAvlladnghevllwgrrldpelveelnadrenkrylpgvllpnllattdleeale
00425341   1/1  lsmvlkgkkvaviGaGliGlalalllallgl..geVvlyDinpekleglaadladilelllvkgriratt
00475101   1/1  sepiadtvlvlilnllrdllgarqrlsagllrlkpllglelkgkkvviiGaGnvGralakvlralGa...
00515751   1/1  -akklrvgiiGaGrigrgahlralaalp.gvlelvavadrdpekaealaeelgiakvyddleelladpdi
00367851   1/1  kgkkvlviGaGgiGralaraLaeaGa...evtvadrslekaealaaelggveavelDvtdeasldaalgd


                         -         -         *         -         -         -         -:140
query           IVVEKVLKEVKDSVLTHDPVLVSVVTGVSVAELEDILGSKDVKIVRTMPNVNVEIGEGMTALHKNDNVSD
00517971   1/1  qlveevlkalkp.....gklvidvaagidiealaealke.ggivvrvapntgalvgagatalvagagvde
00509101   1/1  qaveevlaelag....kgalvidiaagipieelaealpeag.lvvrdmpnlgalvgagataltllaggde
00509091   1/1  ----------------------------------------------------------------------
00517961   1/1  ----------------------------------------------------------------------
00428661   1/1  .dVvlydrnevglrkgssslekaeelgvillvltvadlaeavagADlvilavpdeatadvlee.iapllk
00502691   1/1  paavkavlnglaellallkpgailidvssglpvdtealaaalaeggi.lvaglpvfggepgaglgvltph
00475501   1/1  vvilavppeavrevleelapll..egkivvdvtnglpidtllllvlsgpslaeevaellpgarvvkafnt
00487551   1/1  dadvvilavptpsavkevlegllpl.lkpgaividtstvspgt.teelaklleekgi.lfvdapvsggpa
00528371   1/1  vptpavrevleellpl.lkpgailidvssgkpittealaeal.gervigahpvsggevgapegaladlfe
00518731   1/1  giAlvadevlaeagmkvaligisgligsslaralkkkg...kevivsnrsaatlerle.elGvkvttdla
00523291   1/1  paavrevlegllpl.lkpgaividlstgspldtealaealeekg.ilfldapvsggepgaragpltimag
00484161   1/1  llealaeadlvvnatpagmaplvlelllplllellkpgllvidiaygpletpllklara...aglrvvdG
00470321   1/1  ggeavsldelaealaeaDivinatpaglpvitlellepglllallkkgalvidlaypplvdell------
00504431   1/1  alaritgttdl.ealadadlVieavpenldvklavlae.leallkpgailasntsslsitaladalg.rp
00481021   1/1  ttdleeavkdadlviiavptdalrsvlrqlakllkdvllkkgaiivsltsgipvgtlallseiieevlgg
00484541   1/1  pgvDvvieatpagahaevalaalea...........................g.khvvvekptaltveea
00472941   1/1  saalevakslapvl--------------------------------------------------------
00512351   1/1  viavppelvlevakeale...agvkvlvekpggfne.ellelaeeag..irvvgpn--------------
00475161   1/1  pl....eaineealaalkkgailintsrgalvdeeallelleagkiagagldvlsgeplg----------
00355351   1/1  ealadaDvvilavptpavrsvl.aelapllkpgaivvdlstglvgtieallaallegvlalagldvldap
00440441   1/1  ptqlhaelal------------------------------------------------------------
00509381   1/1  atpnslhae-------------------------------------------------------------
00421801   1/1  sdleeleealggaDivvnatgaglpglllelllellkp--------------------------------
00463571   1/1  eealkdaDlviiavgtplkdgdgrpdldivnavaeeiakll.gpdtivvsstvpvgtteylatpll.gid
00487571   1/1  ----------------------------------------------------------------------
00452431   1/1  kVivydrspekleel....dglgvdsleellkeaDvvilavpltpetkglinaellall-----------
00509141   1/1  avPaeaaqevade---------------------------------------------------------
00512851   1/1  liiat-----------------------------------------------------------------
00497301   1/1  gadlvllavPsqalrevlkqlkpll..k------------------------------------------
00425341   1/1  dlyealkgaDvviiavgvprkpgliael....lkrgdl--------------------------------
00475101   1/1  evtvydidesrleel....dgrvvdsledllkdaDvviiatplnl-------------------------
00515751   1/1  DaVviatpn-------------------------------------------------------------
00367851   1/1  aDvvinaapvglh...aeiveaaleagkhvvdenplaaetralle-------------------------


                         +         -         -         -         -         *         -:210
query           EDYQLVKELFEKIGKVADIEEKDFSTFVALAGSSPAFVYFFIDSLARSGVKYGLNKQKATQIAAQAVLGS
00517971   1/1  ealelvlellealgkvvvvee-------------------------------------------------
00509101   1/1  ealelvepllealgkvvvve--------------------------------------------------
00509091   1/1  -------------------deslldavtalsGsgPAyvflliealadaavklGlsrelAlelalqtllGa
00517961   1/1  ---------------------elldavtalsGsgPAyvflliealadaavklGlsrelAlelalqtllGa
00428661   1/1  pgail.sfahGisidelalagillpadvdVimvaPklpgl------------------------------
00502691   1/1  vggdeealervlpllealgkt-------------------------------------------------
00475501   1/1  iaaarladlfaglgflvlvagdde..ealklvialaaglggldpvdlgdlaaaa----------------
00487551   1/1  gaglg.ltilvggdeealekvkpllealgkkvv.------------------------------------
00528371   1/1  gplviltpmaggdeea------------------------------------------------------
00518731   1/1  eAvkgADivilavppgdav---------------------------------------------------
00523291   1/1  gdeealervrpllealgavvy-------------------------------------------------
00484161   1/1  lemlvgqaaeafel--------------------------------------------------------
00470321   1/1  ----------------------------------------------------------------------
00504431   1/1  grviglhffnpvplmplve.lvp-----------------------------------------------
00481021   1/1  hpfavlsgPefareva------------------------------------------------------
00484541   1/1  vvpl.......velvelaeekgvvlgvgfgv.rflppvvkale---------------------------
00472941   1/1  ----------------------------------------------------------------------
00512351   1/1  ----------------------------------------------------------------------
00475161   1/1  ----------------------------------------------------------------------
00355351   1/1  lsgpeflaeggalllva-----------------------------------------------------
00440441   1/1  ----------------------------------------------------------------------
00509381   1/1  ----------------------------------------------------------------------
00421801   1/1  ----------------------------------------------------------------------
00463571   1/1  vlssPeflregaallh------------------------------------------------------
00487571   1/1  ----------------------------------------------------------------------
00452431   1/1  ----------------------------------------------------------------------
00509141   1/1  ----------------------------------------------------------------------
00512851   1/1  ----------------------------------------------------------------------
00497301   1/1  ----------------------------------------------------------------------
00425341   1/1  ----------------------------------------------------------------------
00475101   1/1  ----------------------------------------------------------------------
00515751   1/1  ----------------------------------------------------------------------
00367851   1/1  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           ALKVLKSDKTPWELVDDVSSPGGTTVAGLLAMEEAGFMTSIVKGVDATISKDKG----------------
00517971   1/1  ----------------------------------------------------------------------
00509101   1/1  ----------------------------------------------------------------------
00509091   1/1  aklllesglhpaelrdkvtspgGtTiagllvleegglrsalieavlaalerakelg--------------
00517961   1/1  aklllesglhpaelrdkvtspgGtTiagllvleegglrsalieavlaalerakel---------------
00428661   1/1  ----------------------------------------------------------------------
00502691   1/1  ----------------------------------------------------------------------
00475501   1/1  ----------------------------------------------------------------------
00487551   1/1  ----------------------------------------------------------------------
00528371   1/1  ----------------------------------------------------------------------
00518731   1/1  ----------------------------------------------------------------------
00523291   1/1  ----------------------------------------------------------------------
00484161   1/1  ----------------------------------------------------------------------
00470321   1/1  ----------------------------------------------------------------------
00504431   1/1  ----------------------------------------------------------------------
00481021   1/1  ----------------------------------------------------------------------
00484541   1/1  ----------------------------------------------------------------------
00472941   1/1  ----------------------------------------------------------------------
00512351   1/1  ----------------------------------------------------------------------
00475161   1/1  ----------------------------------------------------------------------
00355351   1/1  ----------------------------------------------------------------------
00440441   1/1  ----------------------------------------------------------------------
00509381   1/1  ----------------------------------------------------------------------
00421801   1/1  ----------------------------------------------------------------------
00463571   1/1  ----------------------------------------------------------------------
00487571   1/1  ----------------------------------------------------------------------
00452431   1/1  ----------------------------------------------------------------------
00509141   1/1  ----------------------------------------------------------------------
00512851   1/1  ----------------------------------------------------------------------
00497301   1/1  ----------------------------------------------------------------------
00425341   1/1  ----------------------------------------------------------------------
00475101   1/1  ----------------------------------------------------------------------
00515751   1/1  ----------------------------------------------------------------------
00367851   1/1  ----------------------------------------------------------------------