[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for lsal0:ABE00097.1


[Show Plain Result]

## Summary of Sequence Search
   1::807
   2::802 7.9e-281 47.9% 0052910 00529101 1/1   lycosyltransferase/glycogen phosphoryla 
   1::798 1.6e-278 46.6% 0051304 00513041 1/1   lycosyltransferase/glycogen phosphoryla 
   4::798 8.2e-248 41.4% 0046587 00465871 1/1   lycosyltransferase/glycogen phosphoryla 
   1::796   3e-242 39.3% 0048983 00489831 1/1   lycosyltransferase/glycogen phosphoryla 
   1::807


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MDFNKEVFKEKFKNRLDEKYALDVKDATPQELYLTLSSIVRSSYSRYWRKTWKKYMEDGKKQIYYFSIEF
00529101   1/1  -lalnlllsldldaeelfrsllphlwlllgknpvlaldlvlylalallvrdllllrwldtvlalldkdlk
00513041   1/1  leelegllllelellesllelekelllslldllllldveslkesllrhllltlgldllealaldlylala
00465871   1/1  ---edvltlkksllehlllllglalnlatswdlylalalavrdrllerwlntvelllevdakrvyylsle
00489831   1/1  dlllldvellklsvldhlpltlgkllelatnldwylalalalrdrllelwletqe....npvklvyylsl


                         -         -         *         -         -         -         -:140
query           LPGRLLMSNLLNMGWLETVRDALKDLDIDLDEIAEVEKDMALGNGGLGRLASAFMDSLASDGLPGNGNGI
00529101   1/1  rvaYlSmEFllgrlLsnnllnlglldevkealaelgldleellelepdaglgnGGLGrLAadfldsaadl
00513041   1/1  lavrdlllelwletweallenpvklvyylslefLiGrllannllnlglldevleeldeyledtlvkeals
00465871   1/1  fllgrlldnallnlglylevkealaelgldlediayfeaeagLgnGGLGrLAadfldsaadlglPlvgyG
00489831   1/1  efllgrlldnallnlglldevkealaelgldleeiayfeaeagLgnGGLGrLAadfldsaadlglPlvgy


                         +         -         -         -         -         *         -:210
query           RYRYGLFKQKFIDGYQIELPNEWLDSGNPWEIRRESKSVTVRLGGKVYLVDRGNYLEPVYEDAQLIKAVP
00529101   1/1  glplvGyGllYeyGyfrQliddgwqvelpddwlleglpwelvrdelgvpvlfgglve....tgllvvvwl
00513041   1/1  elgldlvalfsaEfdlplgnGGLGrLAadfldsaadlglPlvGyGllYeyGyfrQlivdGwqvelpdywl
00465871   1/1  llYeyGyfrqlivdGwqvelpdlwlreglpwelvrdevavlvgflGdvvlaldk....alwvdgelvlav
00489831   1/1  GllYeyGyfrQlivdGwqvelpdlwlreglpwfvrsevaeplvkfgGladvvgd.......lpkalavlg


                         -         -         -         +         -         -         -:280
query           YDTAIVGYKNGTVNTMRLWDAEIPSSEEAKYRTIEQRREVEDLVSVLYPDDSKESGRILRLKQEYFFVSA
00529101   1/1  pgrtvlavaydvpvvGygnntvntLrLWsaealdefdlelfnvgdyllalldtdlaenitkvLYpgdstl
00513041   1/1  reglPweierpelavlvkfgGrvelvldedgkllrvvwvdgevvlavaydvpipGygtdrvvtlrlWkae
00465871   1/1  aydvpipgygtnrvvtlrlwsaeavggvdlylldtgdyldavenkllaenitsvLYggdstyagkelRla
00489831   1/1  vavdvpipgYgtgrvvtlrlwsalavggvdlylldagdytdavlnkplarnitgvlYggdsdyadnelRl


                         -         *         -         -         -         -         +:350
query           GIQSIVRHFKKYNKSMNKIGEYIGIHINDTHPAMSVAELMRILVDEEHMSWDDAWKQTVAVMSYTNHTIM
00529101   1/1  eGkelRlkqeyflgsaglqdllrlglkaklgareelgldlddlpekvvihlndthpalailelmrllvde
00513041   1/1  avgrfdlylldtgdyldavenkllaenitsvLYpgdstleGkelRLkqeyflgiaglqdivrrlkalgid
00465871   1/1  qeyflgiaaledilrrlglllgdlleevlldlsdlpepdvihlnDwhpalavpellrllvdeeglswdea
00489831   1/1  aqeyflgiaaleailrrlgllgldlsdlpepdvihlnDwhpalaipellrllvdeeglsfdeaweivrkt


                         -         -         -         -         *         -         -:420
query           AEALEKWPVHIMQQVQPRILQIIQEIDRRFVEEKQGKYARDMIERTRIIKDNQVRMANLSIIGSHSTNGV
00529101   1/1  eglswdeaweivrktfvyTtHTplpealekwpvdllerllprhleiiyeinerflelvrellpgdldllr
00513041   1/1  ldelpelvvihlndtHpalailElmrllvdeegldwdeAweivrktfvyTtHTllpealekfpvdllekl
00465871   1/1  weivrattvfTiHtllpqGlerfpvdllerlLprhleiiyglnldfllalglefpgdldllrrlsiieeg
00489831   1/1  tvfTiHtllpqGlerfpvdllerllprhleiiyglnrefllllglefpgdldllrrlsiieegrvnmakl


                         -         -         +         -         -         -         -:490
query           AKLHTELLKDDVLHDFYVMYPERFNNKTNGITDRRWLQIANPELSKVLDKAIGTEWRQDPTKLQKLLKHQ
00529101   1/1  rlsiieegggklvrmavlalvlshsvnGVaklhsevlkemllklfyelypekfnnvTNGvtprrWlllan
00513041   1/1  lprhleiiyeinarflelvrlklgldlelllrlsiieegdlgdlvnmavlAlvlshavngVsklHselvk
00465871   1/1  gggrvnmaklaivlsdavngVSplhaeevktplfgglygllpekltgitNGvdprrWlllanpeldklit
00489831   1/1  aivlsdavngVSplyseiltpelgaglygllpeklvgitNGidprrWlllanpeldklidalygadwlld


                         *         -         -         -         -         +         -:560
query           NDNKVLNQIANAKLKNKERLAKFIEKETGIKVSTDAIFDVQIKRLHAYKRQLLKLMHIVKLYLDIKQGKV
00529101   1/1  pelaelidellgddwltdldelkklldladdeelleallavklelkerlaelikeqlgvlldpdalfdvq
00513041   1/1  rdmfkdfyelygpekitnvTNGvtprrWlllanpeladlidellgldlddwltdlellakledladdeel
00465871   1/1  allgadwltdldellklldladdeellelllelKaankaaLaeliqerlglpvdpdalligfvkRlteyK
00489831   1/1  ldellelldfiddeellelllelKaankaalaeliqeelgleldpdalligfvkRlteyKrqdLnlleal


                         -         -         -         *         -         -         -:630
query           ASDFQPRVFIFGAKAAPSYYYAKAIIKCINEVANMVNNDPEIGDKLKVVFLEDYRVSLAEKIIPAANISE
00529101   1/1  vkRlheYKRqlLnvlhilrlyerlkelln.ldlvPrvfifaGKAaPgyllakliiklinsvadvvnndpd
00513041   1/1  lelllelklelkellaelllkerlgvvvlleelld.dalfivfvkRlheYKRqlLnlLhiierllrilnl
00465871   1/1  rqdLnllhalerllrllnnp.eldlvpvqfvflGkaaPgdllakliiklindlaevvnndpevpgllkvv
00489831   1/1  erllrllndp.eldlvPvqlvflGkaapgyelakeiiklinelaevynndpevrglLkvvfligydvsla


                         -         +         -         -         -         -         *:700
query           QISLASKEASGTSNMKLMLNGALTVATLDGANIEIKDYVGEDNIFIFGLTKDEVYDYYNNGNYHSYDYYN
00529101   1/1  vgdllkvvFlenYdvslAellipaaDlseqiptaglEASGTsnmkfalNGaltlgtlDGanvEiyeevgg
00513041   1/1  lllnpeleerldlvPrqififaGkAaPgyelakliiklinevaevvnndpevrgllkvvFlenYdvslAe
00465871   1/1  flenYdvslaeliyagaDlslqiPsrgfEpsGtsqmkamlnGalplvtldGglvetvedvgeengflFgl
00489831   1/1  ellyagaDlslqiPsrgfEpsGlsqmkamlnGtlpivtldGglvetvedvgengffifgftfeevedlla


                         -         -         -         -         +         -         -:770
query           NHEEIRRVLNAFVDGTIPNCQAEGQEIFDSLTKYNDEYFVLRDFESYVNIQEMVDRTYSNKRHWNQMSLV
00529101   1/1  engflfgltaeevlelrrdg.ydardlyelleelkevldllasglfspgdpelfkelvplll.drdlylv
00513041   1/1  llipgaDlslqiPtaglEAsGTsnMkaalnGaltlgtlDGanvEiveevGeengflfGltaeevlel...
00465871   1/1  daeevedllaal.yralalyelleelkevvdlamsgdfswddsalyldlydsll.kndiylvladFssyr
00489831   1/1  al.yraldlyelleelkevvdlamsgdfswldselylelynsllslapdfyrvladyelYleaqekvdal


                         -         -         *         -         -         -         -:840
query           NIAYGGMFSSDDTIKRYAEDIWNISPLKDEKHGTYSL---------------------------------
00529101   1/1  ladfesYleaqekvdelygdpeeWlkmailni--------------------------------------
00513041   1/1  rdydaldlyeadpllkllldlilpgffs------------------------------------------
00465871   1/1  mvqeyvdelYldaaewlrkailniarsg------------------------------------------
00489831   1/1  yrdqlaWtkksilniarvglfssdrt--------------------------------------------