[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for lsal0:ABE00183.1


[Show Plain Result]

## Summary of Sequence Search
   1::618
 532::613  5.1e-10 26.8% 0050142 00501421 1/1   C-terminal domain-like                  
 528::615  8.3e-10 25.0% 0052804 00528041 1/1   C-terminal domain-like                  
 398::547  1.7e-08 21.2% 0047346 00473461 1/1   )-binding Rossmann-fold domains         
 401::527  2.3e-08 23.6% 0048027 00480271 1/1   )-binding Rossmann-fold domains         
 401::531  4.2e-06 18.0% 0052803 00528031 1/1   )-binding Rossmann-fold domains         
 401::534  7.2e-06 20.5% 0040651 00406511 1/1   )-binding Rossmann-fold domains         
   1::618


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MSVSFLIVTLAAFITPMVLARFKVSFLPTSVAEIIIGIIIGKSCFNLIHADTLLSWCSTFGVILLMFLSG
00501421   1/1  ----------------------------------------------------------------------
00528041   1/1  ----------------------------------------------------------------------
00473461   1/1  ----------------------------------------------------------------------
00480271   1/1  ----------------------------------------------------------------------
00528031   1/1  ----------------------------------------------------------------------
00406511   1/1  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           MEIDFSLFKKNSHTLSPLEAKMAANEPKTSPVRAATYAYAFSLVASLILALLFKVTGLFSDVGLATILFS
00501421   1/1  ----------------------------------------------------------------------
00528041   1/1  ----------------------------------------------------------------------
00473461   1/1  ----------------------------------------------------------------------
00480271   1/1  ----------------------------------------------------------------------
00528031   1/1  ----------------------------------------------------------------------
00406511   1/1  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           TVSLGIMTSLLKENELLSRPFGQTILLFSVLGEVIPMIALTAYSSIYAGKGASLWLITLLFIAAAFLFNR
00501421   1/1  ----------------------------------------------------------------------
00528041   1/1  ----------------------------------------------------------------------
00473461   1/1  ----------------------------------------------------------------------
00480271   1/1  ----------------------------------------------------------------------
00528031   1/1  ----------------------------------------------------------------------
00406511   1/1  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           FRHFFSFFDKINKATTQIDMRLAFFVIIALVLVAETVGAENILGAFVAGIVLKLLEPAEETEHRLDAIGY
00501421   1/1  ----------------------------------------------------------------------
00528041   1/1  ----------------------------------------------------------------------
00473461   1/1  ----------------------------------------------------------------------
00480271   1/1  ----------------------------------------------------------------------
00528031   1/1  ----------------------------------------------------------------------
00406511   1/1  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           GFFTPFFFILTGVNLDIPSLMRSPKTLLLIPLFFVAFILAKLPGYFGFQRRFSKKNSFVGAVATSTTITL
00501421   1/1  ----------------------------------------------------------------------
00528041   1/1  ----------------------------------------------------------------------
00473461   1/1  ----------------------------------------------------------------------
00480271   1/1  ----------------------------------------------------------------------
00528031   1/1  ----------------------------------------------------------------------
00406511   1/1  ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           VVTTLKIAEHLHAITPQQSGAFLLAGILTCIVGPVFFNKQYKPEPEDQKQTSLHIIGVNLVTVSAAQQLS
00501421   1/1  ----------------------------------------------------------------------
00528041   1/1  ----------------------------------------------------------------------
00473461   1/1  -----------------------------------------------klkmhviiiGagrvGrslarlLl
00480271   1/1  --------------------------------------------------mhviiiGlGrvGrlvarlLl
00528031   1/1  --------------------------------------------------nhviiiGlgrvgqllarlL.
00406511   1/1  --------------------------------------------------mhviiiGlGrvGlalarlLl


                         -         -         +         -         -         -         -:490
query           KGMYDVQMYTDNSKNFTTYNSQANVHFLDSLDPDELIANHIFDTDILVLGYADYNVNYKLSLAAKKYGVN
00501421   1/1  ----------------------------------------------------------------------
00528041   1/1  ----------------------------------------------------------------------
00473461   1/1  eegidvvvidrdperveelaeelellgvlvivgdatdpevLeeagieeadavialtdddeanlliallak
00480271   1/1  elgidvvvidldpervellaellgvlvvvgdatdpevLeeagiedadavvaatgddeanllivllakelg
00528031   1/1  egidvvvidldeerveelrelgvlvivgdatdeevLeeagiekadavivatdddeanllivllarelnpd
00406511   1/1  elgidvvvidideerveelrelgvlvvvgdatdedvLeeagiedadavvvatgddeenllivllarklnp


                         *         -         -         -         -         +         -:560
query           RVIVRFENRNPLNDMEDELKKAGIEYFSYFDINVGMMRSMIDSPSMLQILTSSESRLYEVVVNDSIFVGV
00501421   1/1  -----------------------------------------lpnvldlllldgdlelvevvvpegsplvg
00528041   1/1  -------------------------------------rllllpnvldvleldgdlelvevvvpegsplvg
00473461   1/1  elnpdlriiarardpeylellek....lgadevispellaalllarlvlrplvvdvl-------------
00480271   1/1  pkriiarard....pehaellrklgadvvispeleaa---------------------------------
00528031   1/1  lkiiarardeehaellkr..lgadlvispellaalllarlv-----------------------------
00406511   1/1  vlkiiarardpehaellrk..lgadlvispeleaalrlarlvls--------------------------


                         -         -         -         *         -         -         -:630
query           EVKDLPHIDKITISRIYRNGHAIAPHGYTQLQLGDHIIFSASAEESAYFRRKLQRRNE------------
00501421   1/1  ktlaeldlrerygvtvvairRggeliisplgdtvLeagDiLlvvGtpedlerl-----------------
00528041   1/1  ktlreldlrerygvlvvairrggeliinplgdtvLqagDvLlvvGtpedlerlle---------------
00473461   1/1  ----------------------------------------------------------------------
00480271   1/1  ----------------------------------------------------------------------
00528031   1/1  ----------------------------------------------------------------------
00406511   1/1  ----------------------------------------------------------------------