[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for lsal0:ABE00227.1


[Show Plain Result]

## Summary of Sequence Search
   1::180
   1::180  2.3e-76 60.0% 0040968 00409681 1/1   omal protein L5                         
   2::180  1.8e-72 59.8% 0039125 00391251 1/1   omal protein L5                         
  24::178  1.2e-55 59.0% 0037532 00375321 1/1   omal protein L5                         
   1::180


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MVNRLKEKYDNEIVPSLMEKFNYTSIMQAPKVDKIVINMGVGDAVSNAKRLDEAVDELTLIAGQKPVITK
00409681   1/1  pmlrlkllykevivpdlllkfnyknvmqvpklekivlnigvgealsdgklllsaalvLelitgqkPvitk
00391251   1/1  -mlrlkllykevvvpdlllkfnyknvmqvpklekivlnigvgealsdgklltsaalvLelitgqkPvitk
00375321   1/1  -----------------------knvmrvpkiekivlnigvgealen...lllaalvLelitgqkPvitk


                         -         -         *         -         -         -         -:140
query           AKKSIAGFRLREGMAIGAKVTLRGQRMYEFLDKLVSVSLPRVRDFHGVSKRAFDGRGNYTLGIREQLIFP
00409681   1/1  akksiagfkiRkgmpiGvkvtLrgekmyeFLeklltlvlPrvrdfrglsvksfdgtgnfsfgieeqilfp
00391251   1/1  akksiagfkiRkgmpiGvkvtLrgekmyeFLeklltvvlPrirdfrglsvksfdgtgnfsfgieehilfp
00375321   1/1  akksiasfkirkglpigvkvtLrgekmyeF........LprildfrglslksfdgtgnfsfgikehilFp


                         +         -         -         -         -         *         -:210
query           EIDFDDVNKVRGMDIVIVTTANTDEESRELLTQLGMPFAK------------------------------
00409681   1/1  eieydpfigirGlditivttaktdrearlllsglgipfkk------------------------------
00391251   1/1  eieydpfigirGmditivttaktdrearlllsglgipfkk------------------------------
00375321   1/1  eieydpiigifGmditivttrpglrvaktdkearllls--------------------------------