[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for lsal0:ABE00229.1


[Show Plain Result]

## Summary of Sequence Search
   1::122
   1::122  4.2e-50 59.8% 0053143 00531431 1/1   omal protein L14                        
   1::122    6e-50 62.3% 0044974 00449741 1/1   omal protein L14                        
   1::122  3.8e-47 61.0% 0037536 00375361 1/1   omal protein L14                        
   1::122


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MIQQESRLKVADNSGAREILVIKILGGSRVKTANIGDIIVATVKQATPGGVVKKGDVVKAVVVRTKYGTH
00531431   1/1  MiqlgtllnvaDnsGaklvlcisvlggnrlrlasvGdivvvsvkkakpelkvkkgevvkAvivrtkkelr
00449741   1/1  miqlgtlLnvaDnsgaklvlcikvlgknrlrlakvGdiivvsvkkakpklkvkkgdvvkAviVrtkkelr
00375361   1/1  leglklrvllmiqvgtllnvaDNsgaklvlcisvlggkgrlnrlplakvGdlivvsvkkakp...vkkge


                         -         -         *         -         -         -         -:140
query           RPDGSYIKFDENAAVIIGEDKSPKGTRIFGPVARELRDGNFMKIVSLAPEVL------------------
00531431   1/1  rkdgslirfddNavvllnkkgeplgtrifgpvarelrekkflkilslApevl------------------
00449741   1/1  rkdgslikfddNavvllnkkgeplGtrifgpvarelrdkkflkilslapevv------------------
00375361   1/1  vvkAviVrtkkelrrkdgslikfddNavvlinkkgeplGtrifgpvarelrd------------------