[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for lsal0:ABE00286.1


[Show Plain Result]

## Summary of Sequence Search
   1::296
  68::295  2.8e-60 40.0% 0042443 00424431 1/1   ouridine synthase                       
  77::298  6.1e-60 38.9% 0050102 00501021 1/1   ouridine synthase                       
  82::278  2.1e-40 40.7% 0050199 00501991 1/1   ouridine synthase                       
  84::276  1.5e-37 37.4% 0047872 00478721 1/1   ouridine synthase                       
  81::267  2.6e-32 35.9% 0043606 00436061 1/1   ouridine synthase                       
  42::289  5.2e-28 23.2% 0052542 00525421 1/1   ouridine synthase                       
  81::242  4.8e-07 22.1% 0051811 00518111 1/1   ouridine synthase                       
   1::296


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MKFTWNKESDEKMTLKKFLKNKGVSHRTLSSLKKGNGKVLVDGKKRSLSIEVGKGKITLILPPEKSDENV
00424431   1/1  -------------------------------------------------------------------eel
00501021   1/1  ----------------------------------------------------------------------
00501991   1/1  ----------------------------------------------------------------------
00478721   1/1  ----------------------------------------------------------------------
00436061   1/1  ----------------------------------------------------------------------
00525421   1/1  -----------------------------------------dllllklllkvlgkllvlvllltplglgv
00518111   1/1  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           KMSKEPLDIIYEDSNWLVVDKPPLLSSVPGPSNRTDTLVNRVKFHLWQQKSKDLVPHVITRLDRDTSGLV
00424431   1/1  lvevlgldilyededllvlnKPagllvhpgdgllrgtlldlllallgd.lggllrlypvhRLDkdTsGll
00501021   1/1  ------ldilyedddllvlnKPagllvhpgdgllrgtlldlllall.....glprlypvhRLDrdTsGll
00501991   1/1  -----------edddllvlnKPagllvhpgdgl.rgtlldlllallg......lrlylvhRLDkdTsGll
00478721   1/1  -------------ddllvlnKPagllvhpgdglgr.tlldlllall......lprlypvhRLDrdTsGll
00436061   1/1  ----------yeddgllvldKPagltshpvvgklrrll.............gvkkvghvgrLDpdtsGvL
00525421   1/1  lpedrplkvlyedg.llvldKPagltshdvvgkvkrtl.............glkkaghvGtLDplasGvL
00518111   1/1  ----------glvlelglkvdpeldvlvlgrplklllldgvllldKPagvtShdvv.akvrrlldll...


                         +         -         -         -         -         *         -:210
query           LVAKHRFAQGLINKQVEEHSIDKKYLAVVEGIITEKHGIIDKPLGPRENGIGQMVTDTGKIAKTEYWVRE
00424431   1/1  llakdgeaarrlseqfpkreveKtYlalvegvpped.glidlplgvllddglklavledgkpavtlfrvl
00501021   1/1  llakdgeaarrlselfperkveKtYlAlvagvpeeeegtilaplvrlpdgrlklavvvleggkpavtryr
00501991   1/1  llakdgelarrl..lfpkrkveKtYlalvlgvlteellglldlg...........vlldgkpaltlyavl
00478721   1/1  llakdgeaarrl..lfpkrkveKtYlalvagvlteellgtldag...........vvldgkpavtlfavl
00436061   1/1  vlalgg.atkllsyllk...vdKtYlalvllglatdtgdidgeiletlgrdpltrekiekllasflgeil
00525421   1/1  vvalge.atklvkyl...ldvdKeYvalvrlgvatdtgdlegeileftgeilqvpPlrsavkrdgrraye
00518111   1/1  .........kvghvGtLDplatGvLllalgg.atkllspll...dvdKtYlatvrlvgliteealeklla


                         -         -         -         +         -         -         -:280
query           YLGDKATLVECKLHTGRTHQIRAHFSSINHALVGDELYGGRLDWGLERQALHAYQLAYVDPFTQEEKLFK
00424431   1/1  erlg.glslveltlltGRtHQiRvhlaalghpilgDplYggllllllllllllrlkrlgigrlaLhAyrl
00501021   1/1  vlerlg.glslveltlltGRtHQiRvhlaalghpilgdprygigellldlllaggllkrlaLhAlrLsfl
00501991   1/1  erlg..lslleltlltGrthqiRvhlaalghpilgdkrygignlllgld...lhagelrfltplelll--
00478721   1/1  erl..glslleltlltGrthqiRvhlaalghpvlgdkrygignllllgrlalgawrllflhellll----
00436061   1/1  qvPPlysavkvnGkrlYelaregvevelearkvaitslellefdgplglslvelrve-------------
00525421   1/1  larkglevelpllllevtcskG..tyiRslvhdlglpLgcgAhvseLrRtrvgpftlddaltledlalla
00518111   1/1  gftgeilqvPpmysavkvdarpvtiyelelle--------------------------------------


                         -         *         -         -         -         -         +:350
query           SEMPKDLENLIVRLKN------------------------------------------------------
00424431   1/1  sfphpltgelrelta-------------------------------------------------------
00501021   1/1  hpltgellefeaplpedf----------------------------------------------------
00501991   1/1  ----------------------------------------------------------------------
00478721   1/1  ----------------------------------------------------------------------
00436061   1/1  ----------------------------------------------------------------------
00525421   1/1  llllfelpl-------------------------------------------------------------
00518111   1/1  ----------------------------------------------------------------------