[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for lsal0:ABE00290.1


[Show Plain Result]

## Summary of Sequence Search
   1::273
  31::271  1.1e-32 25.2% 0048935 00489351 1/1   /beta-Hydrolases                        
   6::261  5.8e-31 20.2% 0046729 00467291 1/1   /beta-Hydrolases                        
  16::270  6.7e-31 27.7% 0048053 00480531 1/1   /beta-Hydrolases                        
   5::273  1.8e-30 26.1% 0046639 00466391 1/1   /beta-Hydrolases                        
  29::274  2.1e-30 21.9% 0046412 00464121 1/1   /beta-Hydrolases                        
  29::243  6.2e-30 24.0% 0046202 00462021 1/1   /beta-Hydrolases                        
   9::274  2.5e-29 21.1% 0046718 00467181 1/1   /beta-Hydrolases                        
  31::240  3.6e-29 23.1% 0048675 00486751 1/1   /beta-Hydrolases                        
   6::238  4.2e-29 19.8% 0046502 00465021 1/1   /beta-Hydrolases                        
  29::273  4.7e-29 25.0% 0046169 00461691 1/1   /beta-Hydrolases                        
  29::273  1.2e-28 27.2% 0049630 00496301 1/1   /beta-Hydrolases                        
  31::243  1.3e-28 28.9% 0045186 00451861 1/1   /beta-Hydrolases                        
  31::247  1.8e-28 27.5% 0039914 00399141 1/1   /beta-Hydrolases                        
   1::275  3.4e-28 25.4% 0039602 00396021 1/1   /beta-Hydrolases                        
   5::237  5.4e-28 25.8% 0041128 00411281 1/1   /beta-Hydrolases                        
   1::262    6e-28 23.8% 0047601 00476011 1/1   /beta-Hydrolases                        
  31::270  1.2e-27 27.1% 0050226 00502261 1/1   /beta-Hydrolases                        
  29::239  2.6e-27 23.5% 0048126 00481261 1/1   /beta-Hydrolases                        
  29::267  4.1e-27 22.3% 0049928 00499281 1/1   /beta-Hydrolases                        
  29::273  2.1e-26 26.8% 0048207 00482071 1/1   /beta-Hydrolases                        
   4::274  1.9e-24 21.6% 0050947 00509471 1/1   /beta-Hydrolases                        
  31::273  4.9e-24 25.0% 0048460 00484601 1/1   /beta-Hydrolases                        
  31::273  6.2e-24 26.3% 0048945 00489451 1/1   /beta-Hydrolases                        
   3::273  8.9e-24 23.3% 0041193 00411931 1/1   /beta-Hydrolases                        
   1::275  2.2e-23 20.2% 0048633 00486331 1/1   /beta-Hydrolases                        
  18::262  3.6e-23 25.5% 0045824 00458241 1/1   /beta-Hydrolases                        
  31::262  6.5e-23 27.2% 0047003 00470031 1/1   /beta-Hydrolases                        
  29::235  3.5e-22 25.5% 0053045 00530451 1/1   /beta-Hydrolases                        
  30::269  6.3e-22 26.4% 0050245 00502451 1/1   /beta-Hydrolases                        
  33::242  6.7e-22 24.9% 0049383 00493831 1/1   /beta-Hydrolases                        
   5::268  2.1e-21 23.5% 0049887 00498871 1/1   /beta-Hydrolases                        
   9::273  3.9e-21 24.3% 0046793 00467931 1/1   /beta-Hydrolases                        
  29::262  4.2e-20 23.8% 0046670 00466701 1/1   /beta-Hydrolases                        
  31::273  4.2e-20 23.9% 0039526 00395261 1/1   /beta-Hydrolases                        
  18::244  5.3e-20 22.8% 0047600 00476001 1/1   /beta-Hydrolases                        
  29::263  7.8e-20 25.1% 0047940 00479401 1/1   /beta-Hydrolases                        
   1::273  1.3e-19 21.1% 0036443 00364431 1/1   /beta-Hydrolases                        
  16::273    1e-18 23.8% 0049631 00496311 1/1   /beta-Hydrolases                        
   1::273  3.4e-18 22.7% 0047683 00476831 1/1   /beta-Hydrolases                        
  30::266  8.3e-17 21.8% 0047764 00477641 1/1   /beta-Hydrolases                        
  24::275  8.6e-17 22.5% 0048825 00488251 1/1   /beta-Hydrolases                        
  27::262  5.6e-16 25.8% 0048982 00489821 1/1   /beta-Hydrolases                        
  26::242  3.2e-15 24.9% 0053348 00533481 1/1   /beta-Hydrolases                        
  28::270  3.1e-14 21.4% 0048194 00481941 1/1   /beta-Hydrolases                        
   5::271  3.2e-14 24.4% 0047388 00473881 1/1   /beta-Hydrolases                        
   1::215    4e-14 23.1% 0043326 00433261 1/1   /beta-Hydrolases                        
  25::242  9.5e-14 24.1% 0049087 00490871 1/1   /beta-Hydrolases                        
  36::237  1.2e-13 26.9% 0049128 00491281 1/1   /beta-Hydrolases                        
  27::208  1.7e-13 26.8% 0047034 00470341 1/1   /beta-Hydrolases                        
  32::237  1.8e-13 24.4% 0038343 00383431 1/1   /beta-Hydrolases                        
  32::262  2.3e-13 23.8% 0047200 00472001 1/1   /beta-Hydrolases                        
   1::273  3.7e-13 19.8% 0048003 00480031 1/1   /beta-Hydrolases                        
  37::249  4.3e-13 26.5% 0051883 00518831 1/1   /beta-Hydrolases                        
  28::209  4.8e-13 27.5% 0046624 00466241 1/1   /beta-Hydrolases                        
  27::238  9.1e-13 23.9% 0045851 00458511 1/1   /beta-Hydrolases                        
  32::242  9.4e-13 25.0% 0047627 00476271 1/1   /beta-Hydrolases                        
  31::209  1.6e-12 25.0% 0048008 00480081 1/1   /beta-Hydrolases                        
  27::262    2e-12 24.0% 0047444 00474441 1/1   /beta-Hydrolases                        
  27::152  3.5e-12 26.6% 0047220 00472201 1/1   /beta-Hydrolases                        
   7::270  7.9e-12 23.2% 0046077 00460771 1/1   /beta-Hydrolases                        
  33::247  1.2e-11 25.0% 0049037 00490371 1/1   /beta-Hydrolases                        
  27::152  1.5e-11 27.8% 0046012 00460121 1/1   /beta-Hydrolases                        
   1::246  2.6e-11 23.1% 0047495 00474951 1/1   /beta-Hydrolases                        
  27::237  2.6e-11 25.3% 0045886 00458861 1/1   /beta-Hydrolases                        
  34::244  3.6e-11 25.6% 0047317 00473171 1/1   /beta-Hydrolases                        
  27::262  3.7e-11 24.5% 0050206 00502061 1/1   /beta-Hydrolases                        
  31::243  4.2e-11 23.9% 0046410 00464101 1/1   /beta-Hydrolases                        
  33::243  1.4e-10 24.6% 0048965 00489651 1/1   /beta-Hydrolases                        
  27::265  2.8e-10 23.4% 0046573 00465731 1/1   /beta-Hydrolases                        
  13::240  3.1e-10 23.1% 0045741 00457411 1/1   /beta-Hydrolases                        
   1::274  3.6e-10 22.1% 0046388 00463881 1/1   /beta-Hydrolases                        
   6::263  3.7e-10 22.8% 0047194 00471941 1/1   /beta-Hydrolases                        
  27::262  6.6e-10 24.6% 0045736 00457361 1/1   /beta-Hydrolases                        
  34::263    7e-10 22.8% 0050112 00501121 1/1   /beta-Hydrolases                        
  34::241  1.6e-09 24.3% 0044560 00445601 1/1   /beta-Hydrolases                        
  32::262  1.8e-09 23.7% 0051001 00510011 1/1   /beta-Hydrolases                        
  16::241  2.2e-09 19.9% 0049591 00495911 1/1   /beta-Hydrolases                        
  33::243  2.3e-09 23.4% 0045984 00459841 1/1   /beta-Hydrolases                        
   5::263  4.2e-09 23.1% 0045742 00457421 1/1   /beta-Hydrolases                        
   3::263  2.8e-08 23.4% 0046004 00460041 1/1   /beta-Hydrolases                        
  27::237  7.2e-08 23.2% 0041081 00410811 1/1   /beta-Hydrolases                        
  26::243  1.7e-07 23.0% 0048075 00480751 1/1   /beta-Hydrolases                        
  25::218  9.1e-07 22.4% 0046221 00462211 1/1   /beta-Hydrolases                        
  32::269  2.2e-06 20.3% 0042551 00425511 1/1   /beta-Hydrolases                        
  35::269  2.3e-06 20.9% 0040046 00400461 1/1   /beta-Hydrolases                        
  27::262    1e-05 25.3% 0037239 00372391 1/1   /beta-Hydrolases                        
  33::240  5.8e-05 21.9% 0042339 00423391 1/1   /beta-Hydrolases                        
  28::235  0.00041 23.6% 0047879 00478791 1/1   /beta-Hydrolases                        
   1::273


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MQKITEKITVAGHTAELMGYTIEKKNDWGVQDKHATIIICPGGGYHFVSDREADPVALKLITMGYNAFVL
00489351   1/1  ------------------------------sdpvvttslgtvrGllgggvyaFlgIPYAkpPvgelRFkp
00467291   1/1  -----edspvVttslgtvrGlllsllgggvyaFlgIPYAkpPvgelRFkpPqplepwsgvldatkygpac
00480531   1/1  ---------------pwsgvldllllllllllllllllllllllatkfgpacpqpvdlyppgvevedvti
00466391   1/1  ----kpPvlaagagelrfkppepwsllgvldatllgplcpqllpppgvevedvtipgsdgrlplrlylPa
00464121   1/1  ----------------------------sspvVttslGtvrGlllsltgggvyaFlGIPYAkpPvgelRF
00462021   1/1  ----------------------------dpvvttslgstvrGllgdgvyaFlgIPYAkpPvgelRFkpPq
00467181   1/1  --------edlPvVttslGtvrGllltllllgggvyaFlgIPYAkpPvgFkpPqppepwsgvldatkygp
00486751   1/1  ------------------------------pvvttslGtvrGlllsllgggvyaFlgIPYAkpPvgelRF
00465021   1/1  -----dspvvttslgtvrGlllsllgggvyaFlgIPYAkpPvgelRFkpPqplepwdgvldateygpacp
00461691   1/1  ----------------------------apvvttslGltvrGllldgvyaFlgIPYAkpPvgelRFkpPq
00496301   1/1  ----------------------------dspvVttslgtvrlGllgggvyaFlgIPYAkpPvgelRFkpP
00451861   1/1  ------------------------------dsppvvttslgtvrgllltllltgggvyaFlgIPYAkpPl
00399141   1/1  ------------------------------ppvvttslgtvrgllltllltgggvyaFlgIPYAkPPvge
00396021   1/1  mkillklllllspvvltllglvrglldggvdvflgipyakppvgelrfppvppepwdgvrdatkygpacp
00411281   1/1  ----sdppvvttslGtvrgllllllltgggvyaFlgIPYAkPPvgelRFkpPqplepwdgvldatkygpa
00476011   1/1  lgllPvgelRfkaPvplepwpacpqllslllpgllinkllekllrslldpepgvevedvtiptsdgrlyl
00502261   1/1  ------------------------------dgmsepvtitseDglylnvtltlpeispgpkPvvvflHGG
00481261   1/1  ----------------------------sssspvvttslgtvrGlllsllgggvyaFlgIPYAkpPvgel
00499281   1/1  ----------------------------sslsspvvttslgtvrGlllglgvyaFlgIPYAkpPvgelRF
00482071   1/1  ----------------------------lallllllltlllpallpppgvpveevtvptpdGvrlhyrly
00509471   1/1  ---epelvtfksrdgtelpgllylPagfdpgkkyPvlvylhGgpgsqgvpnffsflllaqllasrGyvvv
00484601   1/1  ------------------------------fkllllllllllltlllpplppppgvpveevtvptpdGvr
00489451   1/1  ------------------------------dlpgvpveevtiptpdGvrlplrlylPagadpggklPvvv
00411931   1/1  --veveevtfksadgtklpgllylPpgadpggkyPvvvllhGgggssgvpdsfsllplaqllasrGyvvv
00486331   1/1  lp..veevtipspdgdrlplrlylPagyapggklPvvvllHGg...ggsseswalfgrplaralaaraGy
00458241   1/1  -----------------Mrlylylpp...gggplpvvvllHGgg...gsaeswrplaealaerlpgyvvv
00470031   1/1  ------------------------------rlpallalllllaallaslpappggtveevtipsrdgdrp
00530451   1/1  ----------------------------lPellslpgvtveevtvptpdgvrlplrlylPagpggklPvv
00502451   1/1  -----------------------------asfsldldllllsysspttppelylfldllllellllpllt
00493831   1/1  --------------------------------llpipalyvvelvffstvdgdklplrvylpkgklPvvv
00498871   1/1  ----eevrteiltldg....lrlyypp......gggklPvvvllHGgg...gsaeswrplaealaerGyr
00467931   1/1  --------tvdglrlpyrlylpag.....gggpkplvvllHGlg...gsgadwrplaralaeagfrvvap
00466701   1/1  ----------------------------sspggpvveesvtstvdgdrlplrvylPagag.PvvvllHGg
00395261   1/1  ------------------------------mkllllllllallllstagpagvtvetvtipsdggrlpgr
00476001   1/1  -----------------gllllllalllaslpslpggtveevtvtspvdgdtlplrvylPagydpggplP
00479401   1/1  ----------------------------vgllsldldllllsysslttpsdlylfddlllaelellllta
00364431   1/1  lpvetvtiptgdg..rlpaylylPag....agpapvvvllhglggss...asfrplaralaarGyavlap
00496311   1/1  ---------------maldllvtvttpdGvrlayrlylPag..agpkkgppvvllHGgg...gsseswrp
00476831   1/1  dlppveevtvttpdGvrlhyrlylPpg....ggplPvvvllHGgggssgswrplfrslaraLaerGyrvv
00477641   1/1  -----------------------------lfdplllfdpevlldiselisklgypveevtvttedGltlp
00488251   1/1  -----------------------lellsslkpfggvllkltvystadgrelsvyvylPpgalfsdsdpgk
00489821   1/1  --------------------------llllllllllllllllllvlllllllkllepllnpveertvtvd
00533481   1/1  -------------------------ery.pe.pgppvvllHGlggsaeswwlpsswrplaeaLaeaGyrv
00481941   1/1  ---------------------------gslllalllrllellkldlllellllllklellleplevefvd
00473881   1/1  ----allvpveevtvtvdglrlayrlygppg....gpklpvvlllHGlg...gsseswrplalaealaar
00433261   1/1  melislllgfgglqkvyslaflrllvslpsapdgldvrfllytpdnpeigqllllldplllyrpgfngdr
00490871   1/1  ------------------------PPyrpsgggpgp.pvvllHGgggssesw...rplaealaerGyrvi
00491281   1/1  -----------------------------------alpvevetvtvpvdgdclhlvylPalPavvvllhG
00470341   1/1  --------------------------mkillillllllllllliglllrplsrllllpalenllfllytp
00383431   1/1  -------------------------------kklPVvvyiHGGgfvlGsassydgsalarrlaaagrgvv
00472001   1/1  -------------------------------dlellldisellkklgvpveevtvttpdGvrlhyrlylp
00480031   1/1  lsevelvtfktadGlelhgylylpag.....gkkpvvvllHGgpgssdr.gsfrplaqylaarGyavvav
00518831   1/1  ------------------------------------ivvapdlrgsggssapydp...............
00466241   1/1  ---------------------------mkllllllllllllllllllllalllllpylpseldvrfllyt
00458511   1/1  --------------------------lrllepllvpveertvttpdGlrlhyreyg.ppsgppvvllHGl
00476271   1/1  -------------------------------GgpdglrayllpgpgsgppvvllHGlg...gsaeswrpl
00480081   1/1  ------------------------------mklllllllllllllllasllqrpllllpssppeldvrll
00474441   1/1  --------------------------pveegrfvtvdglrlhyreag..sg.ppvvllHGlggglgsses
00472201   1/1  --------------------------mkllllllllllllllllllllllllllpllppeldlrfllytl
00460771   1/1  ------elpfeertvtvdglrl.hyleag.pgdkppvvllHGlgpG..pgsseswrplapaLae.gyrvi
00490371   1/1  --------------------------------lrllepllypfeeryvtvpdGlrlhyreygppsgppvl
00460121   1/1  --------------------------Kklllllllilllllplgtllfrlplllppppddldvrfllyln
00474951   1/1  ml.eertvttdglrlh...yreag........sgppvvllHGlggvigsseswrplaeaLaa.gyrviap
00458861   1/1  --------------------------lllllrywrdifdwltlepllvpfeefvtvsdglrlhyreygpp
00473171   1/1  ---------------------------------HppvlllHGlggsaeswr...plaealaeaGypdvrv
00502061   1/1  --------------------------lPeelplvpfeertvttpdGlrlhyreag..dg.ppvvllHGlg
00464101   1/1  ------------------------------PpgggsgppvvllHGlggssesw...rplaeaLaarGyrv
00489651   1/1  --------------------------------ggaalvllHGlggssesw...rplapaLaerGyrviap
00465731   1/1  --------------------------lelepllnpveertvtvgdGlrlhyreagp...gppvvllHGlg
00457411   1/1  ------------prfvtvdglrlh.yreag..dg.ppvvllHGlggsse...swrplaeaLaerGyrvia
00463881   1/1  klaytletvsipldgvelyvllllpagl.....grp.ViflnGlgsnlavttfeayaglakrlaekGyiV
00471941   1/1  -----efvtvdggdllllrlhyreag......dgppvvllHGlggssesw...rplaeaLaerGyrviap
00457361   1/1  --------------------------erfvtvdglrlhyreyg.pgdkppvvllHGlggsseswr...pl
00501121   1/1  ---------------------------------erfvtvdglrlhyreagpgppvvllHGlggsseswr.
00445601   1/1  ---------------------------------gppvllvhGlggssssh.wwrplaealasagyrvval
00510011   1/1  -------------------------------dgp.pvvllHGlggssesw...rplapaLaerGyrviap
00495911   1/1  ---------------fetkslllrlpdgviitlvlykpedag..dkskpvvlfihGgsggselpvyanla
00459841   1/1  --------------------------------maalvpfeertvtvdglrlhyreygppsgppvvllHGl
00457421   1/1  ----sefvtvdg..lrlhyreagp.........gppvvllHGlggssesw...rplaeaLaerGyrviap
00460041   1/1  --Ppeterlvtvdg.lrlhyreagp.........gppvvllHGlggssesw...rplaeaLaarGyrvia
00410811   1/1  --------------------------peegrfvtvdglrlhyrevgppdgkptvvllHGgpggss...gs
00480751   1/1  -------------------------rlhyrpag..egkppvvllHGlggsse...swrplapaLad.gyr
00462211   1/1  ------------------------l.ppgagsgp.pvvllHGlg...gsseswlllgywrplaeaLaerG
00425511   1/1  -------------------------------eertvtvdgvrlayreygppdgp.pvlllHGlggssas.
00400461   1/1  ----------------------------------gdsLlavrllarlplsllfdaptveelaalldsrlv
00372391   1/1  --------------------------yrgdgegp.pvvlvHGlggsasswlldywrs...laeaLaeaGy
00423391   1/1  --------------------------------dgppvllvHGlggssysw...rslaelLaaalpGyrvi
00478791   1/1  ---------------------------ypgpgsgpp.vvlvHGlgg...ssrswrpgldywlgpkdslae


                         -         -         *         -         -         -         -:140
query           NYTCQVRYPVALEQLAQSVKLVRDNADEWNVREDKIIIMGMSAGGHLAASLGVKWNSNELKQMGYKSEEI
00489351   1/1  PvplepwdgvrdatkfgpacpqlpplllvvlldvvygsedclylnvytPagpsgklPvvvyiHGGgfvlg
00467291   1/1  pqlplllppllsglevedldvpgsedclylnvytPkappdgklPvvvyiHGGgfvlgsasshlylarala
00480531   1/1  pspdgdprlplrlylPag...pggklPvvvflHGGgflggsaeswrplaralaarlGyavvapdyrghge
00466391   1/1  g...pggklPvvvflHGGgflggsaeswrplaralaarlGyavvapdyrghgesggpagledlaaaldwl
00464121   1/1  kpPqppepwsgvldatkygpacpqppslllplllglllllppvpgsEdclyLnvytPagalldlllllgl
00462021   1/1  plepwsgvldatkfgpacpqllllllllllllplllplllgvlvedvvipgsedclylnvytPagaapdg
00467181   1/1  acpqlgvllldvpgsedclylnvytPalglsasgklPvvvyiHGGgfvlgsasshlylllllylarrlaa
00486751   1/1  kpPqplepwdgvldatkfgpacpqllpllpplppgvlvedltipgsedclylnvytPagaggklPvvvyi
00465021   1/1  qllsllldllpgvlvedlvipgsedclylnvytPagasgklPvvvyiHGGgfvlgsadshlylarrlaar
00461691   1/1  plepwsgvldatkfgpacpqllllllllllllplllppllgvdvedvvipgsedclylnvytPkgassgk
00496301   1/1  qplepwsgvldatkfgpacpqllllllllllllllllllllsllldllvltvllpvvpgsedclylnvyt
00451861   1/1  RFkpPqplepwsgvldatkygpacpqpvtskdvtygsedclylnvytPkgaspeskklPvlvyiHGGgfv
00399141   1/1  lRFkpPqplepwsgvldatkygpacpqpssllpalpglpgsvvedlvvpgsedclylnvytPagaspgkk
00396021   1/1  qppppgvevedvtipsgdgdclplrvyrPagpggplPvvvyiHGGgfvggsadlptydrlaralaaagyv
00411281   1/1  cpqlssllplplpplvtvedvtvvagdedclylnvytPagadsgkklPvvvyiHGGgfvlgsassyd.la
00476011   1/1  rlylP......ggplPvvvllHGGgflggsadswrplaralaarlGyavvapdyrghgesggpaaledla
00502261   1/1  gfllgggsaesfrplaralaarG.ll...nvvvlvapdyrghgespgpagledlaaaldwlldn.....l
00481261   1/1  RFkpPqppepwdgvldatkygpacpqllplllpdllgltvellvvpgsedclylnvytPaappsgklPvv
00499281   1/1  kpPqplepwsgvrdatkfgpacpqlvvsldivygsedclylnvytPagaapdgklPvvvyiHGGgfvlgs
00482071   1/1  lPag.ggklPvvvllHGgggssgsagswrplaeaLaarGkpldtdrvyrVvapDyrGhGgSdgpapeapy
00509471   1/1  avdyrgsggsggafldagrgnlggveldDlvaaldwlleqggvDpdriaifGhSyGGylalalalalldr
00484601   1/1  lhyrlygPpgggplPvvvllHGggfvsgvaalgsseswrplggnsaraLaarGyrVvapDyrGhGeSlgp
00489451   1/1  llHGgggssgsps.wrplaralaarlGyavvapdyrGhGesggpptpagaaysgedlaeDlaaaldwlre
00411931   1/1  apdyrGsggsggafrdagpgnlgpadveDliaaldylral...ggvdpdriallGhSyGGylalalaary
00486331   1/1  avvapdyrGhgesggppadagsgnlglldledlaaaldalldalgidpervvlvGhSmGGalalalalry
00458241   1/1  apdyrggplgflgglqlfdllrghgespgpagllysledlaadllalldalaelgldpdriglvGhSmGG
00470031   1/1  lrvylPagydpggklPvvvllHGgggssgsalssldswrplaealaarGdlppyrvvap......pgpyg
00530451   1/1  vllHGgggssgsa.swrplaralaarGyrvvapdyrggpehGfssgppgladggdllaedlaaaldwlle
00502451   1/1  lldpllfdlpgveveevtiptpdGvrlpyrlylPpggggklPvvvllHGggg...sseswrp.araLaar
00493831   1/1  llhGgggssgsaswspygglaealaergyivvapdyrgggegflwpsssgppgnfgledlldalaedlid
00498871   1/1  vvapdyrghgesdgppddysledlaedllaaldwlreniavfggllllldpl.rvvlvGhSmGGalalal
00467931   1/1  dypghgespnpgaggrawfdilalspggpedeagledaaedlaalidallrlgidperivlvGfSmGGal
00466701   1/1  ggsagspswrnygglaealaerGyivvapdyRgggflrghgdsdgppgnfglldiedaladelidalida
00395261   1/1  lylPagadagklPvvvllhGlg...gsaesyrglaralasrGyavvapDlrghgespgppvedllaaldy
00476001   1/1  vvvllHGgggssgswslyrplaralaarliglgklpgyvvvapdyrGhgesggpaagndgeddaedllal
00479401   1/1  lllpelfdlpgveveevtiptpdGvrlhyrlylPdgggklPvvvllHGgggsseswr...plaraLaarG
00364431   1/1  dlrghglsggppdpalpldlgallallaaysldalvedleaaldylraqpvdagkvglvGhSlGGalall
00496311   1/1  laeaLaarGyrVvapDlrGghGrsdglppdysledlaeDlaalldalreq......gpervvlvGhSmGG
00476831   1/1  apDyrGhGgSggppysgedladDlaaaldalren...lgid.ervvlvGhSmGGalalalaaryPd....
00477641   1/1  lylylpptygelgggpkppvlllHGlg...gsseswldlgperslaeaLaerGyrvvapdlrGhGgsagp
00488251   1/1  klPvlvllHGltgsaeswlektglaellaelGyavvapdlrgsgesgrpfeddawdfgggagfyvnated
00489821   1/1  glrlhyrlygp.gdgppvvllHGlggsses...wrpltgpgpglaeaLaarGyrViapDlrGhGrStgpv
00533481   1/1  iapdlrGhGgSdgpp...ysledlaedlaalldal.....giekvvlvGhSmGGlvalelaarype....
00481941   1/1  vdglrlhypppgggsgplpvvllHGgggssgsp.swrplaraLaa.gyrviapDlrGhGeSdgppdrlgp
00473881   1/1  GyrvvapdlrGhGlSdgppsllpysledlaadlaalldal.....glervvlvGhSmGGllalllaaryp
00433261   1/1  pvvvllHGlggsags.swwlplaralaarlgynvvavDyrghgrspypaaaydledlaadlaalldalia
00490871   1/1  apdlrGhGgsdgpppdysledlaedlaalldallel......gpekvvlvGhSmGGllalalaaryp...
00491281   1/1  gggsagsaslelyrglaralaarGyivvapdyrGfggsgpppadgnyglldqlaaaaldwlran...lgi
00470341   1/1  lnpeevrfvtvdgllrlhyylpg..ksgpvvvllHGgg...gssespywrplaeaLakrGdyrvvapDyr
00383431   1/1  vVsvnYRlgalGflslgdllpeapgnagllDqvaAlrWvqeniaafGgDpdrvtlfGeSAGGalvallal
00472001   1/1  kpppppgggpgppvlllHGlggssgswldlgperglaeaLaerGyrVvapDlrGhGrStgpgflddgpgd
00480031   1/1  dyrGsggsggpfdnygpdeveDllavidwlvkrggaftgrtggkeakqpwdngkvgllGhSyGGylalll
00518831   1/1  .......adafldflaeellplldalypvgadpdrvvlaGhSmGGllAlylalryPe.............
00466241   1/1  lenpevrfitvdglrlyyppsg.dgkkpvvvllHGgg...gsaespywrplaeaLakrGgyrvvapDyrG
00458511   1/1  ggsseswr.....apaLaaalgyrviapDlrGhGrSdgppdlgdysledladdlaalldal.....giek
00476271   1/1  araL.a.gyrvvavdlrGh.......edlaadlaalldalg.....pdrPvvlvGhSmGGllalalaarl
00480081   1/1  lytpeniesrdgdtlglrlyypesgdgpkpvvvllHGgg...gsaespywrplaraLadrGdyrvvapDy
00474441   1/1  wrplapaLae.gyrviapDlrGhGlSdgppgpdysledladdllalldal.....giekvvlvGhSmGGl
00472201   1/1  pleevrittedglrlhyrppg.dgkgpvvvllHGgg...gsaespywrplaraLaerGgyrvvapDyrGh
00460771   1/1  apDlrGhGrSdgppsleysledlvddlaadlealldal.....gidkvvlvGhSmGGlialalaaryper
00490371   1/1  llHGlggssesw....plapaLaeagyrviapDlrGhGrSdgppdlgdysledlaadlaalldal.....
00460121   1/1  lnpeevtfvdvdglrlyypppg.dgkkpvvvllHGgggssgspy.wrplaraLaerGgyrvvapDyrGhG
00474951   1/1  DlrGhGlSdgppapysledladdlaalldal...gidg.pvvlvGhSmGGllalalaaryper.......
00458861   1/1  dgp.pvvlllHGlggssesw...rplaeaLaarGyrviapDlrGhGrSdgppspadysledladdlaall
00473171   1/1  iapdlrghglsd..eysledlaadlealldalgl..ekvvlvGhSmGGlvalllaarlpaldr.......
00502061   1/1  gssesw...rplapaLadrGyrviapDlrGhGrSdgppdfpdysledladdlaalldal.....giekvv
00464101   1/1  iapDlrGhGrSdgppspdysledladdlaalldal.....gidepvvlvGhSmGGlvalalaarype...
00489651   1/1  DlrGhGrSdgppgpdysledladdlaalldal...gid.ekvvlvGhSmGGlialalaaryper......
00465731   1/1  gsse...swrplaeaLaeaGyrviapDlrGhGrSdgppspypysledladdlaalldal.....glepvv
00457411   1/1  pDlrGhGrSdgppgdysledladdlaalldal.....glepvvlvGhSmGGllvalalaaryper.....
00463881   1/1  llvdyglsgsyddlpldatgepgrggfsildqdvkdlvellekl...tdvdlekiiliGhSlGgivalll
00471941   1/1  DlrGhGrSdgppgdysledladdlaalldal.....glepvvlvGhSmGAGlvalalaaryper......
00457361   1/1  apaLaeaGyrviapDlrGhGrSdgpps...dysledladdlaalldal.....giekvvlvGhSmGGlia
00501121   1/1  ..plaeaLaerGyrviapDlrGhGrSdgppsdysledladdlaalldal.....glepvvlvGhSmGGlv
00445601   1/1  dlpghgls..slddwvedllalldal.....g.epvvlvGhSlGglvalrlaarlpela...........
00510011   1/1  DlrGhGrSdgppsplysledladdlaalldal...gid.ekvvlvGhSmGGlialalaaryper......
00495911   1/1  kdLvrqGydvllvdyrgsgesdvp.lsledlaelleylvkligp..skivliGhSlGGllallfalllpr
00459841   1/1  ggsseswr...plapaLae.gyrviapDlrGhGrSdgpp.pdysledladdlaalldal.....giepvv
00457421   1/1  DlrGhGlSdgppsdysledladdlaalldal.....glepvvlvGhSmGGlvalaYlaaryper......
00460041   1/1  pDlrGhGrSdgppsd.ysledladdlaalldal.....giepvvlvGhSmGGlvalalaary........
00410811   1/1  wrplipaLae.gyrviapDlrGhGrSdpppgegytlddladdlealldal....lglekvvlvGhSmGGa
00480751   1/1  viapDlrGhGrSdppad..ysledladdllalld.........epvvlvGhSmGGlialalaaryper..
00462211   1/1  yrviapDlrGhGgSdgpp...ysledlaedlaalldal.....giekvvlvGhSmGGlvalalaarype.
00425511   1/1  ..wrplapalllaagyrviapDlrGhGrSdgppdlgapysledlaadlaalldal.....giervvlvGh
00400461   1/1  eadglrllvylpgggagpplvllHGgga.ggsaasyrplaraLaa.gyrvvavdlpgygasepppysled
00372391   1/1  rviavdlrghGrsPysledlaadlealldal.....giekvvlvGHSmGGlvalyaaarrPd........
00423391   1/1  aldlrghGlsdkpgeysledlaadleallealg......ekvhlvGhSmGGlvaralaarlp..erkvks
00478791   1/1  aLakaGyrVialDlr.....p.sdysledlaedlaylkgGtvdywdfsfdeiglydlpaaiealldalgl


                         +         -         -         -         -         *         -:210
query           KPNGLVLSYPVITTNKDFWHQGSFEQILGKDGIEDEKALANQSLEKLVTEDVPPVFMWHTFEDKAVPMEN
00489351   1/1  sassydylaralaarggvvvvsvdYRlaplGflssgdlsleapgpagleDalaalrwvreniaafggDpd
00467291   1/1  arlgvvvvsvdYRLgalGflsapehpsfpgnagllDqlaalrwvreniaafGgDpdritlaGhSaGGala
00480531   1/1  sggpaaledlaaaldwllenldalgidpdrvvlvGhSaGGalalalalrypdrglp.........lvaal
00466391   1/1  lenlaalgidpdrivlvGhSaGGalalalalrypdrglp.........rvaalvllspvldlpasldlps
00464121   1/1  lelPdgkvelldivlrdgdgippggklPvvvyiHGGgfvlgsassylylaralaarlgvvvvsvdYRLga
00462021   1/1  klPvvvyiHGGgfvlgsassydyhylaralaalrlgvvvvsvnYRLaalGflssgdlppeapgpagllDq
00467181   1/1  ragvvvvsvnYRlgvlGflsapehpfpgnagllDqlaalrwvreniaafggDpdritlfGdSAGGalala
00486751   1/1  HGGgfvlgsadsylylarrlaarlgvvvvsvdYRlgalGflssggapeapgpagllDqlaalrwvrenia
00465021   1/1  lgvvvvsvdYRLgalGflssapehpfpgnagllDqlaalrwvreniaafggDpdritlaGhSaGGalala
00461691   1/1  klPVlvyiHGGgfvlGsadsydgsylarrlaalelgvvvvsvnYRLgalGflslgdlspeapgnagllDq
00496301   1/1  PagaapdgklPvvvyiHGGgfvlGsadtyd..arrlaarlvelgkgvvvvsvdYRlgalGflsapehpfp
00451861   1/1  lgsassydylarylaallvllkelgvvvvsvnYRLgplGflssgdeeapgnagllDqlaalrwvreniaa
00399141   1/1  lPvvvyiHGGgfvlgsassyd.garlaaelgvvvvsvnYRlgplGflssgddehpgnagllDqvaalrwv
00396021   1/1  vvsvdyRlaglsfpehpfpaaleDavaalrwlreniaafggd..rvvlaGdSaGGnlalalalrlrdrgl
00411281   1/1  rllaelgvvvvsvnYRlgplGflssgddehpgnagleDqvaalrwvreniaafGgDpdrvtlfGdSaGGa
00476011   1/1  aaldwllenldalgidpdrvvlvGhSaGGalalalalrypdrglp.........rvaalvllspaldlla
00502261   1/1  dpdrivlvGhSaGGalalalalrypdrglplllllldllsllsrvkalvlispvldllalllsllllrkf
00481261   1/1  vyiHGGgfvlgsassylylarrlaarlgvvvvsvdYRLgalGflssapehpfpgnagleDqlaalrwvre
00499281   1/1  adsydylaralaaagvvvlvsvdYRlgalGflsapehpfpasgnlgllDqlaalrwvreniaafggDpdr
00482071   1/1  tllgwgfsledlaeDlaaaldwlren...fgidpervvlvGhSmGGalalalaary.............P
00509471   1/1  ypd.............rfkaavalapvtdlllydsg..ylerylg.lpeenpeaydaysplehadklklt
00484601   1/1  egplslgddflggfgedaadDlaaaldwlren...lgidpervvlvGhSmGGalalalaarl........
00489451   1/1  n...fgidpdrvvlvGhSmGGalalalalrypdr.............vkalvllspaldllalllsllll
00411931   1/1  pd.............lfkaavalspvldlllydtayterylglp.llpedpealkayspleladkikppp
00486331   1/1  pdr.............vkalvllspaldl.talalalllleaglgllpellealraydplellakikavP
00458241   1/1  alalalaslrypd.............rfkalvllspaldlldlllsllllll..................
00470031   1/1  ledlaaaldwlldellginiaafgtlaerlllklgdpervdrvlvGhSmGGalalalalry..Pdr....
00530451   1/1  n....gidp.rvvlvGhSmGGalalalalrypd.............rvkalvllspaldlaallpsllel
00502451   1/1  GyrvvapDyrGhGrSsppaslngalgfasggdfpaatlgdlggvenallrllaeDlaaaldwlren...f
00493831   1/1  lleaklgidpervalvGhSmGGllalalalrypdl.............fkgvillspaldlsdlalsell
00498871   1/1  al............rypd..vkalvllspaldllalllalllllll........lalllaydplellkki
00467931   1/1  alllalrl.............pdrvaglvllsgalplaallp.......................dllel
00466701   1/1  lgidpervalvGhSmGGllalalalryPdl.............fkalvllspaldlladllpflerllka
00395261   1/1  llallearlgvDpdriglvGhSmGGalalllaard............pd..vkavvllapvldl......
00476001   1/1  ldali.rfggdpdrvalvGhSmGGalalalalrypd.............rvkalvllspaldllalalal
00479401   1/1  yrvvapdyrGhGesggppadysledlgfyddeqakpyglhfpmvadDlaaaldwlren...fgidpervv
00364431   1/1  la....apd...........rvkalvllagaldl............................dpledlak
00496311   1/1  llalalaaryp...............vkglvllsppldlsalalallrllllll....lppefledllal
00476831   1/1  .........rvkglvllspaldl.............llddlllpggapllplllalllgdlaalllallr
00477641   1/1  yslgpapgepgdysledlavddlaaaldylrer.....lgiekvvlvGhSmGGllalaaaarlpelge..
00488251   1/1  plakrgrmedylvedlpalidalfpvlaerggidldrvaiaGhSmGGygAlalalrllypd.........
00489821   1/1  sldpgtgkgyyvdatlplllllglglewsllrfdgppgdggaglvysledlaedlaalltdalrartgvl
00533481   1/1  .........rvkglvllapp........ldgspladallellrkallalllkllgllpelllllallrrl
00481941   1/1  ysledlaadllallrdalgid..pvvlvGhSmGGllalalaarlaarype.............rvkglvl
00473881   1/1  e.............rvkglvllspaldllal............................lealakikvPv
00433261   1/1  n...ygidpervhlvGhSlGghvAllaalrl.............p.rvaglvlldpagplfeltdplrrl
00490871   1/1  ............vkglvllspaldlsalpllleallkrlldrllgdelldlllladplllarllldllad
00491281   1/1  dpgrvvlvGhSlGGalalllalryPdl.............vaglvllsgplpgsaaala..........e
00470341   1/1  GrSdgpapddeysledlaedlaalldallen...fgidperivlvGhSmGGllalalaarypd.....--
00383431   1/1  spaleelglsrglfhrailqsgvallpwaltlelalelaralakllgcddsaellecLrsvsaeellkaa
00472001   1/1  pgdysledlaeaDlaaaidyllda.....lgiekvvlvGhSmGGllalalaary............Pelg
00480031   1/1  aarypd.............rlkalvllagvsdlyrdyrehggillpgglpgedldvlaaalysrlllpgd
00518831   1/1  rfagvvalsgslwpsdgplg..............dpealreydplellaklkvpvllihGteDglvppe.
00466241   1/1  hGespgpaalydledaaedlaalidallekygidperivlvGhSmGGalalalaarypd..........-
00458511   1/1  vvlvGhSmGGllalalaaryPer.............vkglvllspplplsaladallllarqallpdlla
00476271   1/1  eeype.............rvaglvllspplplsalalal........rlppgllaallellraldllple
00480081   1/1  rGhGesdgpaglydledaaedlaalidallekygidperivlvGhSmGGalalalaarypd........-
00474441   1/1  ialalaaryper.............vkglvllapalplsa......llplllalllallpeallarllrl
00472201   1/1  Gesdgppglydl----------------------------------------------------------
00460771   1/1  .............vkglvllspalpl..ppllplllarllalllallleallelllrlllspdpltldpe
00490371   1/1  giekvvlvGhSmGGlialalaaryPer.............vkglvllapalplseladwllrllakalle
00460121   1/1  esdgppady...----------------------------------------------------------
00474951   1/1  ......vkglvllspplplsalaplllallllllllellarllallgadpalldpelleallalllrpga
00458861   1/1  dal.....giepvvlvGhSmGGllalalaaryPer.............vkglvllspplplsalapallr
00473171   1/1  ....vaglvllsppl........................lllllldllellakikvPvlvihgedDpvvp
00502061   1/1  lvGhSmGGlialalaaryPe.............rvkglvllapapplsaladallrllaalllalpallf
00464101   1/1  ..........rvkglvllspplplllaslaalllallaallsllllllllallllllgllpallspeell
00489651   1/1  .......vkglvllapppplsalalalllllllelllalllalllallllllgadpslldeeelrallaa
00465731   1/1  lvGhSmGGllalalaaryPer.............vkglvllspplplsapldallealakllaslpdllf
00457411   1/1  ........vkglvllapplplsalalallllllaallalllalllallallaeallaalfgpllrddlll
00463881   1/1  alklpd.............riagvvlldPalnladerlslllgaiayileklglplllkevsnkvldrld
00471941   1/1  .......vkglvllsppapllllaellplgllaallarllalllaglpelllrllallflpplllleell
00457361   1/1  lalaaryl.per...........vkglvllapplplllglppllglllarllalllallgallaellrrl
00501121   1/1  alalaarygper.............vkglvllspplplllladallagllrallaallalllaplllalr
00445601   1/1  rvaglvllapalplleglpel..............lellkrldllellkklpvpvlvihgedDpvvpfel
00510011   1/1  .......vkglvllapppplsaladallrllllalllllllllllyllllllllgglallltdpellall
00495911   1/1  snslvkgvvligpildgviplaaylgrlsllkdlkqpikslslehlledfleilesi.............
00459841   1/1  lvGhSmGGlvalalaaryPe.............rvkglvllspplplsaladaalllllllaallarlle
00457421   1/1  .......vkglvllsppapladladplaglllarllaallalllallpelllrlllelllpllladaell
00460041   1/1  ...Pel.rvkglvllsppadlsaladallpllllallldlllallaallaallerllallgldpllldee
00410811   1/1  lalayAaryPd.............rvkglvllgpagllplellalllllllllpallaallaallallla
00480751   1/1  ...........vkglvllapapplldlaell.arllkalaallalllllleallkrlllllllgllldde
00462211   1/1  ............rvkglvllappldgsaladallellaaallallatllgallallllllllllldpell
00425511   1/1  SmGGaialllaarhpe.............rvaglvllapaaplealapallrllalllarlllptleall
00400461   1/1  laadlaallral.qgdgpvvlvGhSlGGllAlalalrlrdrge.............rvaglvlldpplpl
00372391   1/1  .....rvaslvllgpp........hlgspladllprllpllllealllalagllgallslllgpelllqi
00423391   1/1  lvllapPhlgspladllpllllpdlllklllllllteflqklvpagysrdpllvdlylessifladlnne
00478791   1/1  el.kvvlvGHSmGGlvalaaaarlgpelveklivvdiapvlydgrlawyper.............vkglv


                         -         -         -         +         -         -         -:280
query           SLLFASALRKAGVSTEYHIFPHGPHGLALANEETARVGRPEDIEPQAAQWVDLFHSWMQALLK-------
00489351   1/1  ritlaGhSaGGalalalalsprd..........pgl.faaailispvldltaltpserena---------
00467291   1/1  lalalsprdrgl...........fagailisgvldlpwllpsleenaegal-------------------
00480531   1/1  vllspvldl..eellpsyle.llggppldpelleafldlllgelalralldlldplaspl----------
00466391   1/1  lreladgpllppallerllgallgdpadlldplasplealdkikvPpvliihGedD..vppde-------
00464121   1/1  lGflasapeapfplllealgnagllDqvaalrwvreniaafGgDpdritlfGhSaGGalalala------
00462021   1/1  laAlrwvreniaafggDpdrvtlaGdSAGGala-------------------------------------
00467181   1/1  lalsprdpg...........lfagaillspvldlpwldltealpsarelakalgltaaslaell------
00486751   1/1  afggDpdritlfGhSaGGalalalalsprd----------------------------------------
00465021   1/1  lalsprdpg...........lfagaili------------------------------------------
00461691   1/1  raAlrwvreniaafGgDpdrvtlfGdSAGGhlaaalalrardrg.......splskglfagai-------
00496301   1/1  apgNlgllDqlaalrwvreniaafGgDpdritlaGdSaGGalalalal.....rlrdrgspls-------
00451861   1/1  fGgDpdritlfGdSaGGalaallalsprsrglF-------------------------------------
00399141   1/1  reniaafggDpdrvtlfGdSaGGalaallalsprdpg---------------------------------
00396021   1/1  pp........rvaglvlispvldl...paalpselenlarrlaalaggplltlealarllrlylp-----
00411281   1/1  laallalsprdpglfkrailqsgsall-------------------------------------------
00476011   1/1  lapslaellggdpllppellerlrallledlaalllplasplealakikpPv------------------
00502261   1/1  lleylggdlaedlelllaaspllaedlkkikvPvliihGedDplvppeeaealaealpaa----------
00481261   1/1  niaafGgDpdritlfGhSaGGalalalal-----------------------------------------
00499281   1/1  vtlaGhSaGGalalalalrlsp.........lgpplfagailispvldltwltpsal-------------
00482071   1/1  drvkglvllspaldllpldpallerlllallgdllaallallalllddlpealaallagllal-------
00509471   1/1  plllihGtaDdvvppqqsealaaalkaagvpvellvypgegHgfs..kpenr............------
00484601   1/1  ...yPd..vkglvllspaldl..lpadlpsleralldallddllpllllrllladaallppel-------
00489451   1/1  lllleallgllpellealraysplellkllllakikvPpvliihGedDplvppeeaealaeal-------
00411931   1/1  vllihGtaDdvvppeqsealadalkeagvpvelllypgagHgfl..............kpear-------
00486331   1/1  vliihGedDplvppeeaealaealpaagvpvelvvipgagHgf..............lfleapee-----
00458241   1/1  .......kvPvliihGekDplvppeeaealaealpaagvdvelvvyp.agHg------------------
00470031   1/1  .......vkalvllspald..............glgllledlaallaasple------------------
00530451   1/1  lllllllllllllaallaldplell---------------------------------------------
00502451   1/1  gidpervvlvGhSmGGalalala............arypd..vkalvllspaldlsrll-----------
00493831   1/1  elllkelgekgvprllgnvyleylraydpldl--------------------------------------
00498871   1/1  akvPvliihGedDplvppeeaealaealkaagpnvelvvillpgagHgf.........------------
00467931   1/1  laklkvPvllihGeaDpvvppeaaralaealpaagvskdvelvvypgagHgfp..........-------
00466701   1/1  llgekglpaylgpivpeallaysplellkkliankppvllihGtnelgdlll------------------
00395261   1/1  .........................edlakikvPtlvihgeaDpvvppeqaealaealpaagv-------
00476001   1/1  lllal......................lakikvP------------------------------------
00479401   1/1  lvGhSmGGalalala.rypdr.............vkglvllspaldlaalllp-----------------
00364431   1/1  ikvPvliihGedDplvppelaealaealka.gpdvellvypgagHgffleeagly.......d-------
00496311   1/1  fdeelrdlllgllrallalaeadpledlakikvPvliihGedDplvppedaealaealpaaga-------
00476831   1/1  llleallrllaallllsplladlsylrllalrllaafdnfllalllalrllddyyregdpled-------
00477641   1/1  ........rvkglvllappldlsplaepllrlllalllfldgllgllgllpgella--------------
00488251   1/1  ....rfkavvalspvvnpsllpwgqkafegylgd....dkeaweaydplellkklkglplppvll-----
00489821   1/1  lllanaeslgiglervvlvGhSmGGavalllaaryPe.............rv------------------
00533481   1/1  dllealkkikvlttegallfnakyPnggleap--------------------------------------
00481941   1/1  lsppldlsellesllrlllarlllddlleallgglladpellrdlsplpl.lakikvPvl----------
00473881   1/1  lvihgedDplvppel......alaealpnaelvvlpgagHflll...............ea---------
00433261   1/1  dpsda-----------------------------------------------------------------
00490871   1/1  llalledllealakikvPvliihGedDplvpp--------------------------------------
00491281   1/1  lpeallallggldlelllgpvllgdll-------------------------------------------
00470341   1/1  ----------------------------------------------------------------------
00383431   1/1  splllvgprlaglllfyPvvdgvvlpe-------------------------------------------
00472001   1/1  drvkglvllsppldl....sdlaepllallaalllllaallgllgalllall------------------
00480031   1/1  llkleeayekllaellparyrahplyd.dfwrdrsplenldkikvPvLiihGlaDtlvppeqa-------
00518831   1/1  aralaealpaagipvelvelpgghhwpv.weefladllr-------------------------------
00466241   1/1  ----------------------------------------------------------------------
00458511   1/1  allallpagllaalleallrllallafl------------------------------------------
00476271   1/1  lllaglllklllldllywnldalakikvPvlv--------------------------------------
00480081   1/1  ----------------------------------------------------------------------
00474441   1/1  lgadplllsdelleaylrpllrpdflrallalllalasaldlydadllealk------------------
00472201   1/1  ----------------------------------------------------------------------
00460771   1/1  lleallrlllapgalaalaallrlllsaldlyadllealkkikvPvlvihGedDplvppe----------
00490371   1/1  pllllllalllalllallleallellladlllsddla---------------------------------
00460121   1/1  ----------------------------------------------------------------------
00474951   1/1  lralaalyralldaleradllealakikvPvlvihG----------------------------------
00458861   1/1  llaalllalllalllallrelllrlll-------------------------------------------
00473171   1/1  pesa.........llpnaelvvlpgagHllllen------------------------------------
00502061   1/1  glgallelllaldplallralldllygddalllekfgrwlllenafsvelyp------------------
00464101   1/1  ayllallrpgflaaalallrglldalallarad-------------------------------------
00489651   1/1  llrpgdaeallallralrlalallaradlleal-------------------------------------
00465731   1/1  llggllelllplspaallrlladlplglaallaekfgrwlgfdveslldnqgsal---------------
00457411   1/1  dellellrdlllradlaallallralarld----------------------------------------
00463881   1/1  ldsliellkninipllivhgenDpglllllllllllldivpvensvelleqlleaggknvdfev------
00471941   1/1  dellaalllpflraglrallralrallldlldllerlkaidvPvlvihGedDp-----------------
00457361   1/1  llslllplllsdelleelllallrdlllradlegllallralrradllealk------------------
00501121   1/1  rllgllpallslpellealleylrddllradlrallallralrdadllealak-----------------
00445601   1/1  aerlaeal.....gaelvvipgggHlllleg---------------------------------------
00510011   1/1  lalllagfarallallaglldalallaeadllealkkikvPvlvihGedDpl------------------
00495911   1/1  ..pllilagdkDllvppkqslklaaklrelk---------------------------------------
00459841   1/1  llgalspeellellarllladlldpelleaylr-------------------------------------
00457421   1/1  eallrylldlllradlrallallralaradllealakikvPvlvihGedDplv-----------------
00460041   1/1  lleallalllapggldallaylrallalaldllealakikvPvlvihGedDpl-----------------
00410811   1/1  dllaalllrllfpdallrdpelvaell-------------------------------------------
00480751   1/1  laelllallralgtadllallellralrradll-------------------------------------
00462211   1/1  eallelll--------------------------------------------------------------
00425511   1/1  allallaallpllpeallrallrrllaldflgllfdpallaallealarpgarasleal-----------
00400461   1/1  dp.................ealslldeellaallrlgglpplrlllpalradlralpdy-----------
00372391   1/1  lldalsdlttellaaflellpgsgflaallhgaqlvpgvrygsylrllllnl------------------
00423391   1/1  rallanleykenlsrl.vpvllihgenDgv----------------------------------------
00478791   1/1  llapPhlGspladlll.........---------------------------------------------