[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for lsal0:ABE00302.1


[Show Plain Result]

## Summary of Sequence Search
   1::228
   1::220    3e-70 44.5% 0036777 00367771 1/1   hoglycerate mutase-like                 
   1::221  8.2e-70 45.2% 0043909 00439091 1/1   hoglycerate mutase-like                 
   1::219  2.3e-66 40.2% 0051064 00510641 1/1   hoglycerate mutase-like                 
   2::225  4.1e-66 41.1% 0048955 00489551 1/1   hoglycerate mutase-like                 
   1::223  1.8e-65 40.8% 0049178 00491781 1/1   hoglycerate mutase-like                 
   1::230  2.7e-58 39.5% 0037864 00378641 1/1   hoglycerate mutase-like                 
   3::223  1.9e-53 39.6% 0039931 00399311 1/1   hoglycerate mutase-like                 
   3::220  8.3e-53 39.1% 0035570 00355701 1/1   hoglycerate mutase-like                 
   1::223  2.2e-51 39.3% 0036887 00368871 1/1   hoglycerate mutase-like                 
   3::219  3.7e-47 40.8% 0050036 00500361 1/1   hoglycerate mutase-like                 
   1::228


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MPKLVFIRHGQSEWNLKNLFTGWEDVNLSEKGVEEAKEAGRKLKEAGIEFDQAYTSVLTRAIKTLHFALE
00367771   1/1  mmkrlyLvRHGetewnaegrfqgwlDvpLtelGreqakalgellkelglpfdavysSpllRAiqTaeiil
00439091   1/1  mmkrlyLvRHGetewnaegrfqgwlDspLtelGreqaralgealkelgipfdavysSplkRAiqTaeiil
00510641   1/1  mmmkrlyLvRHGesewnaegrlqgwtDvpLtelGreqaralgerladlgikfdavysSpllRaiqTaeii
00489551   1/1  -prlyLvRHGesewnaegrlqgwtDvpLtelGreqaralgerLadlgikfdlvysSpllRaiqTaeiiae
00491781   1/1  mmmtrlyLvRHGetewnaegrlqgwtDspLtelGreqAralgellaelglkfdavysSplkRaiqTaeii
00378641   1/1  MslnllmtrlyLvRHGetewnaegrlqgwldvpLtelGreqaralgealadlglpfdavysSpllRaiqT
00399311   1/1  --rlyLvRHGetewnvegrlqg..dvpLterGreqaralgerlkdlglpfdavysSpllRaiqTaeii..
00355701   1/1  --rlyLvRHGetewnlegrlqg..dvpLterGreqaralgealadlgipfdavysSpllRaiqTaeii..
00368871   1/1  mtrlyLvRHGetewnvegrlqgdldvpLtelGreqaralgerla..glpfdavysSpllRaiqTaeiiae
00500361   1/1  --mrlyLvRHGetewnlegrfqgwtdvpLtelgraqaralgell.....pfdavysSpllRArqTaelil


                         -         -         *         -         -         -         -:140
query           ESGQLWIPEMKTWRLNERHYGALQGKNKAAAAEKYGDEQVHIWRRSYDVLPPLLSADDEGSAANDRRYAD
00367771   1/1  ealglsllpvvvdprLrErdyGalegltkaeiaekypeelvawwrdpydyrppllelllelllldllrya
00439091   1/1  eelgldklpvevdprLrErdfGalegltkaeiaekypeelvawlrrsydvlpplleeldelllellldya
00510641   1/1  aealglpllpvvvdprlrEidfgalegltleeiaekfpeelvawlrdpldvrppllelldlllllldlry
00489551   1/1  alglpllpvvvdprlrErdfgalegltldeiaekfpeelvlwlrdpldvrppllelldellllldlryal
00491781   1/1  lealglpllpvvvdprLrErdfGalegltkaeiaakypeelvawwrdpydarppalllldlllplldrll
00378641   1/1  aeiilealglpllpvevdprlrErdfgalegltleeiaekypeelvawlrdpydfrp.............
00399311   1/1  .....glpveidprLrEidfgdlegltleeiaekypeelaawlrdpydyrp...................
00355701   1/1  .....glpveidprLrEidfgdlegltldeiaekypeelaawlrdpydyrp...................
00368871   1/1  alg...lpvivdprlrEidfgalegltleeiaekypeelaawlrdpydfrp...................
00500361   1/1  .......lpvivdprLrErdfGawegltldeiaakype.............................wll


                         +         -         -         -         -         *         -:210
query           LDPRIIPGGENLKVTLERVIPFWEDHIAPDLLAGKNVIVAAHGNSLRALTKYIEQISDEDIMNVEMATGQ
00367771   1/1  llpldllpggEsladvvaRvlpaleellarllkdgenvlvVsHggvlrallayllglsledilrlnlpng
00439091   1/1  ladldplldrppggEsladvvaRvlpaleellarllkdggnvliVaHggvlrallayllglsledilrln
00510641   1/1  agllddllpggEsladvaaRvlpaleellarllldgknvlvVsHggvirallayllglpleellrlnlpn
00489551   1/1  ldedllpggEsladvaaRvlaaleellaralkpgknvlvVsHggvirallayllglpleeilrlnipngs
00491781   1/1  adldl..lpggEsladvaaRvlpaleellaellhdgktvlvVaHggvirallalllglpleellrlnlpn
00378641   1/1  ............pggEsladvvaRvlpaleellarllkdgenvlvVsHggvlrallayllglsleellrl
00399311   1/1  ......pggEsladvvaRvlpaleella.....genvlvVsHggvirallayllglsleeilrlnlpngs
00355701   1/1  ......pggEsladvvaRvlpaleel.....edgenvlvVsHggvirallayllglpleeilrlnlpngs
00368871   1/1  ......pggEsladvvaRvlaaleellarl..dggnvlvVsHggvlrallayllglsledllrlrklpng
00500361   1/1  dlldlappggEsladvlaRvlpaleell.......gnvlvvaHggvirallalllglsleeilrlelpng


                         -         -         -         +         -         -         -:280
query           PVVYDLDDKLNIVNKEKL----------------------------------------------------
00367771   1/1  sitvlelddd------------------------------------------------------------
00439091   1/1  lpngsitvlel-----------------------------------------------------------
00510641   1/1  gsvtvleld-------------------------------------------------------------
00489551   1/1  vtvlelddglvslnd-------------------------------------------------------
00491781   1/1  gsvtvlelddggw---------------------------------------------------------
00378641   1/1  nlpngsvtvlelddggwvlv--------------------------------------------------
00399311   1/1  vtvlelddggwvl---------------------------------------------------------
00355701   1/1  vtvleldggg------------------------------------------------------------
00368871   1/1  svtvlelddggwv---------------------------------------------------------
00500361   1/1  svlvleldd-------------------------------------------------------------