[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for lsal0:ABE00312.1


[Show Plain Result]

## Summary of Sequence Search
   1::241
  82::234  8.7e-36 29.4% 0052630 00526301 1/1   smate lyase-like                        
   2::74   8.2e-12 35.6% 0047247 00472471 1/1   ed helix" DNA-binding domain            
   1::70   1.3e-10 38.6% 0050048 00500481 1/1   ed helix" DNA-binding domain            
   6::69   1.1e-06 23.4% 0039384 00393841 1/1   ed helix" DNA-binding domain            
  12::67   3.7e-06 35.7% 0037767 00377671 1/1   ed helix" DNA-binding domain            
   5::67   9.1e-06 20.6% 0043758 00437581 1/1   ed helix" DNA-binding domain            
  31::78    0.0001 33.3% 0048601 00486011 1/1   ed helix" DNA-binding domain            
   3::67   0.00013 25.0% 0045862 00458621 1/1   ed helix" DNA-binding domain            
   8::67   0.00055 27.1% 0045968 00459681 1/1   ed helix" DNA-binding domain            
  33::69   0.00097 37.8% 0038753 00387531 1/1   ed helix" DNA-binding domain            
   1::241


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MAELVYKNIISDLKEKIFAGKFTDMKLPDERSLAEQYNVSRSSVKRALNKMSNEGIIFKKRGSGTFINPL
00526301   1/1  ----------------------------------------------------------------------
00472471   1/1  -slplyeqvaealreailsgelapgdrLPsereLaerlgvsrttvrealrrLeaeglverrpgrgtfVae
00500481   1/1  mldllsslplyeqiaealreaIlsgelapgdrLpsereLaeelgvsrttvreAlrlLeaeglverrpgrG
00393841   1/1  -----llmllderlllillllleggepvsveeLaeelgvsrstvrrdlalLeelglvirrrgggyrlag-
00377671   1/1  -----------dveeRlarlLlllalrlglrlgdgllidlllteeeLAellgvsretvsraLkeLek---
00437581   1/1  ----elterqrlilellvelylkeggpvsvreLaellglgvSraTirrdLaeLeelGllervhggag---
00486011   1/1  ------------------------------eelAellGlssretvsrvLskLkkeglievdggkiiildl
00458621   1/1  --lleltelledylklillllledg.plsvseLaerlgvspptvsralkrLeedGlvererdggdrl---
00459681   1/1  -------lllderrlkillllle.dgrlsveeLaeelgvSrstvrrhlkrLeeaGliiesvpgkgyr---
00387531   1/1  --------------------------------lAellglsretvsrvLkkLekeglieleggritildl-


                         -         -         *         -         -         -         -:140
query           YLKNESIFNYEEGSNLGISDNFRLKGKKPQTKILDFQVIKPTSELQRDLFLSPEDFVYKIIRLRLFEDEP
00526301   1/1  -----------lssltsfteelraqgrkpstevlsfelvpadaevaeaLglepgdpvlrierlrladgeP
00472471   1/1  lsld------------------------------------------------------------------
00500481   1/1  ----------------------------------------------------------------------
00393841   1/1  ----------------------------------------------------------------------
00377671   1/1  ----------------------------------------------------------------------
00437581   1/1  ----------------------------------------------------------------------
00486011   1/1  daLkelaa--------------------------------------------------------------
00458621   1/1  ----------------------------------------------------------------------
00459681   1/1  ----------------------------------------------------------------------
00387531   1/1  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           FMIETGYIPIKILPKLSRTQLESSIFAYIQSELNQTASKSFMSIYAEPSTSEDQNLLKLKENEPVSVMEG
00526301   1/1  valetsylpaalfpglleedlegslyeyLeeelglkitraeetieavladeeeaelLgippgaplllver
00472471   1/1  ----------------------------------------------------------------------
00500481   1/1  ----------------------------------------------------------------------
00393841   1/1  ----------------------------------------------------------------------
00377671   1/1  ----------------------------------------------------------------------
00437581   1/1  ----------------------------------------------------------------------
00486011   1/1  ----------------------------------------------------------------------
00458621   1/1  ----------------------------------------------------------------------
00459681   1/1  ----------------------------------------------------------------------
00387531   1/1  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           IFFLDNGTPFEFSQMRLHFKYLKFNTFINLD---------------------------------------
00526301   1/1  vtyldadgrpveysrslyrgdrfr----------------------------------------------
00472471   1/1  ----------------------------------------------------------------------
00500481   1/1  ----------------------------------------------------------------------
00393841   1/1  ----------------------------------------------------------------------
00377671   1/1  ----------------------------------------------------------------------
00437581   1/1  ----------------------------------------------------------------------
00486011   1/1  ----------------------------------------------------------------------
00458621   1/1  ----------------------------------------------------------------------
00459681   1/1  ----------------------------------------------------------------------
00387531   1/1  ----------------------------------------------------------------------