[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for lsal0:ABE00338.1


[Show Plain Result]

## Summary of Sequence Search
   1::801
 162::576 4.8e-103 32.3% 0048003 00480031 1/1   /beta-Hydrolases                        
 584::801    2e-64 40.5% 0040582 00405821 1/1   tose-binding domain-like                
   1::156    8e-40 39.6% 0040581 00405811 1/1   lyl dipeptidyl aminopeptidase PepX, N-t 
 265::576  1.3e-19 18.8% 0048207 00482071 1/1   /beta-Hydrolases                        
 272::576  1.2e-18 19.7% 0048460 00484601 1/1   /beta-Hydrolases                        
 570::800  3.4e-18 20.9% 0041041 00410411 1/1   tose-binding domain-like                
 567::802  7.4e-17 21.8% 0039760 00397601 1/1   tose-binding domain-like                
 252::545    4e-16 20.3% 0041193 00411931 1/1   /beta-Hydrolases                        
 259::554  1.3e-15 17.9% 0053045 00530451 1/1   /beta-Hydrolases                        
 263::576  5.8e-15 19.3% 0047683 00476831 1/1   /beta-Hydrolases                        
 256::545  7.5e-14 18.6% 0048633 00486331 1/1   /beta-Hydrolases                        
 264::545  1.7e-13 19.2% 0048945 00489451 1/1   /beta-Hydrolases                        
 250::545  1.9e-13 19.7% 0049887 00498871 1/1   /beta-Hydrolases                        
 236::543  3.5e-13 19.2% 0047940 00479401 1/1   /beta-Hydrolases                        
 259::542  1.2e-12 20.2% 0050226 00502261 1/1   /beta-Hydrolases                        
 245::545  1.3e-12 19.2% 0036443 00364431 1/1   /beta-Hydrolases                        
 253::545  7.4e-12 19.2% 0050947 00509471 1/1   /beta-Hydrolases                        
 264::542  3.3e-11 19.0% 0050245 00502451 1/1   /beta-Hydrolases                        
 199::547  1.5e-10 20.2% 0046639 00466391 1/1   /beta-Hydrolases                        
 255::542  1.5e-10 19.1% 0047601 00476011 1/1   /beta-Hydrolases                        
 259::520  2.3e-10 20.9% 0048053 00480531 1/1   /beta-Hydrolases                        
 566::801  6.9e-10 18.9% 0041602 00416021 1/1   tose-binding domain-like                
 272::545  8.4e-10 21.8% 0039526 00395261 1/1   /beta-Hydrolases                        
 253::548  1.1e-09 19.1% 0049383 00493831 1/1   /beta-Hydrolases                        
 264::558  1.3e-09 20.4% 0047600 00476001 1/1   /beta-Hydrolases                        
 261::542  1.5e-09 17.9% 0045824 00458241 1/1   /beta-Hydrolases                        
 263::545  3.4e-08 19.0% 0049631 00496311 1/1   /beta-Hydrolases                        
 244::544  7.3e-08 19.7% 0047388 00473881 1/1   /beta-Hydrolases                        
 256::545  9.6e-08 18.2% 0047200 00472001 1/1   /beta-Hydrolases                        
 248::545  2.7e-07 19.7% 0048825 00488251 1/1   /beta-Hydrolases                        
 240::541  3.1e-07 17.9% 0047764 00477641 1/1   /beta-Hydrolases                        
 262::520  8.4e-07 19.3% 0049128 00491281 1/1   /beta-Hydrolases                        
 264::543  1.2e-06 17.3% 0049087 00490871 1/1   /beta-Hydrolases                        
 265::542  1.6e-06 19.5% 0047003 00470031 1/1   /beta-Hydrolases                        
 246::543  6.9e-06 16.2% 0046077 00460771 1/1   /beta-Hydrolases                        
 261::547  8.3e-06 16.3% 0048075 00480751 1/1   /beta-Hydrolases                        
 248::547  1.3e-05 17.2% 0051883 00518831 1/1   /beta-Hydrolases                        
 272::541  1.7e-05 16.3% 0041081 00410811 1/1   /beta-Hydrolases                        
 273::541  2.9e-05 16.9% 0045886 00458861 1/1   /beta-Hydrolases                        
 254::541  5.3e-05 16.4% 0045851 00458511 1/1   /beta-Hydrolases                        
 242::556   0.0001 17.0% 0045984 00459841 1/1   /beta-Hydrolases                        
 265::508  0.00013 19.1% 0053348 00533481 1/1   /beta-Hydrolases                        
 252::543  0.00014 15.6% 0045742 00457421 1/1   /beta-Hydrolases                        
 263::543  0.00041 19.4% 0048982 00489821 1/1   /beta-Hydrolases                        
 273::543  0.00043 15.6% 0051001 00510011 1/1   /beta-Hydrolases                        
 266::544  0.00055 17.4% 0046573 00465731 1/1   /beta-Hydrolases                        
 254::547  0.00066 15.8% 0049037 00490371 1/1   /beta-Hydrolases                        
 253::545  0.00075 16.9% 0046793 00467931 1/1   /beta-Hydrolases                        
 287::546   0.0009 20.0% 0046670 00466701 1/1   /beta-Hydrolases                        
   1::801


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MKFNQFAHVKVPFEQKLAELNRIAFLHAGDEDLASNHIYRLFLERAFPNFKTEAAKNHALSNLAATENAD
00480031   1/1  ----------------------------------------------------------------------
00405821   1/1  ----------------------------------------------------------------------
00405811   1/1  MkyNqfayidtdletaleELkeigf..dldllasfkelletllkkllleakt..........lladsetd
00482071   1/1  ----------------------------------------------------------------------
00484601   1/1  ----------------------------------------------------------------------
00410411   1/1  ----------------------------------------------------------------------
00397601   1/1  ----------------------------------------------------------------------
00411931   1/1  ----------------------------------------------------------------------
00530451   1/1  ----------------------------------------------------------------------
00476831   1/1  ----------------------------------------------------------------------
00486331   1/1  ----------------------------------------------------------------------
00489451   1/1  ----------------------------------------------------------------------
00498871   1/1  ----------------------------------------------------------------------
00479401   1/1  ----------------------------------------------------------------------
00502261   1/1  ----------------------------------------------------------------------
00364431   1/1  ----------------------------------------------------------------------
00509471   1/1  ----------------------------------------------------------------------
00502451   1/1  ----------------------------------------------------------------------
00466391   1/1  ----------------------------------------------------------------------
00476011   1/1  ----------------------------------------------------------------------
00480531   1/1  ----------------------------------------------------------------------
00416021   1/1  ----------------------------------------------------------------------
00395261   1/1  ----------------------------------------------------------------------
00493831   1/1  ----------------------------------------------------------------------
00476001   1/1  ----------------------------------------------------------------------
00458241   1/1  ----------------------------------------------------------------------
00496311   1/1  ----------------------------------------------------------------------
00473881   1/1  ----------------------------------------------------------------------
00472001   1/1  ----------------------------------------------------------------------
00488251   1/1  ----------------------------------------------------------------------
00477641   1/1  ----------------------------------------------------------------------
00491281   1/1  ----------------------------------------------------------------------
00490871   1/1  ----------------------------------------------------------------------
00470031   1/1  ----------------------------------------------------------------------
00460771   1/1  ----------------------------------------------------------------------
00480751   1/1  ----------------------------------------------------------------------
00518831   1/1  ----------------------------------------------------------------------
00410811   1/1  ----------------------------------------------------------------------
00458861   1/1  ----------------------------------------------------------------------
00458511   1/1  ----------------------------------------------------------------------
00459841   1/1  ----------------------------------------------------------------------
00533481   1/1  ----------------------------------------------------------------------
00457421   1/1  ----------------------------------------------------------------------
00489821   1/1  ----------------------------------------------------------------------
00510011   1/1  ----------------------------------------------------------------------
00465731   1/1  ----------------------------------------------------------------------
00490371   1/1  ----------------------------------------------------------------------
00467931   1/1  ----------------------------------------------------------------------
00466701   1/1  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           ILTYLNSSKINARVFYAVGLQLLGFEAELDFDLKDPFSAMDKLNLPYQKEIHHRDDVINAWYDLLCTSTK
00480031   1/1  ----------------------------------------------------------------------
00405821   1/1  ----------------------------------------------------------------------
00405811   1/1  lleflesdqeltaevFylvalQLLgFlpgvdfdlddplafleklglpilealldtedllsalyllLntrt
00482071   1/1  ----------------------------------------------------------------------
00484601   1/1  ----------------------------------------------------------------------
00410411   1/1  ----------------------------------------------------------------------
00397601   1/1  ----------------------------------------------------------------------
00411931   1/1  ----------------------------------------------------------------------
00530451   1/1  ----------------------------------------------------------------------
00476831   1/1  ----------------------------------------------------------------------
00486331   1/1  ----------------------------------------------------------------------
00489451   1/1  ----------------------------------------------------------------------
00498871   1/1  ----------------------------------------------------------------------
00479401   1/1  ----------------------------------------------------------------------
00502261   1/1  ----------------------------------------------------------------------
00364431   1/1  ----------------------------------------------------------------------
00509471   1/1  ----------------------------------------------------------------------
00502451   1/1  ----------------------------------------------------------------------
00466391   1/1  ----------------------------------------------------------------------
00476011   1/1  ----------------------------------------------------------------------
00480531   1/1  ----------------------------------------------------------------------
00416021   1/1  ----------------------------------------------------------------------
00395261   1/1  ----------------------------------------------------------------------
00493831   1/1  ----------------------------------------------------------------------
00476001   1/1  ----------------------------------------------------------------------
00458241   1/1  ----------------------------------------------------------------------
00496311   1/1  ----------------------------------------------------------------------
00473881   1/1  ----------------------------------------------------------------------
00472001   1/1  ----------------------------------------------------------------------
00488251   1/1  ----------------------------------------------------------------------
00477641   1/1  ----------------------------------------------------------------------
00491281   1/1  ----------------------------------------------------------------------
00490871   1/1  ----------------------------------------------------------------------
00470031   1/1  ----------------------------------------------------------------------
00460771   1/1  ----------------------------------------------------------------------
00480751   1/1  ----------------------------------------------------------------------
00518831   1/1  ----------------------------------------------------------------------
00410811   1/1  ----------------------------------------------------------------------
00458861   1/1  ----------------------------------------------------------------------
00458511   1/1  ----------------------------------------------------------------------
00459841   1/1  ----------------------------------------------------------------------
00533481   1/1  ----------------------------------------------------------------------
00457421   1/1  ----------------------------------------------------------------------
00489821   1/1  ----------------------------------------------------------------------
00510011   1/1  ----------------------------------------------------------------------
00465731   1/1  ----------------------------------------------------------------------
00490371   1/1  ----------------------------------------------------------------------
00467931   1/1  ----------------------------------------------------------------------
00466701   1/1  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           KGQNLLDILANRGYFTQFYQLNLTEPIFFNGKAQPVFDTNKLIHEVVYVESELDTDQDGKRDLLKVIITR
00480031   1/1  ---------------------llnkyllfngkslpvfdtselirevvivedvlitmrdgvldrLaadiyr
00405821   1/1  ----------------------------------------------------------------------
00405811   1/1  knGltliddlvskGfl------------------------------------------------------
00482071   1/1  ----------------------------------------------------------------------
00484601   1/1  ----------------------------------------------------------------------
00410411   1/1  ----------------------------------------------------------------------
00397601   1/1  ----------------------------------------------------------------------
00411931   1/1  ----------------------------------------------------------------------
00530451   1/1  ----------------------------------------------------------------------
00476831   1/1  ----------------------------------------------------------------------
00486331   1/1  ----------------------------------------------------------------------
00489451   1/1  ----------------------------------------------------------------------
00498871   1/1  ----------------------------------------------------------------------
00479401   1/1  ----------------------------------------------------------------------
00502261   1/1  ----------------------------------------------------------------------
00364431   1/1  ----------------------------------------------------------------------
00509471   1/1  ----------------------------------------------------------------------
00502451   1/1  ----------------------------------------------------------------------
00466391   1/1  ----------------------------------------------------------kpPvlaagagel
00476011   1/1  ----------------------------------------------------------------------
00480531   1/1  ----------------------------------------------------------------------
00416021   1/1  ----------------------------------------------------------------------
00395261   1/1  ----------------------------------------------------------------------
00493831   1/1  ----------------------------------------------------------------------
00476001   1/1  ----------------------------------------------------------------------
00458241   1/1  ----------------------------------------------------------------------
00496311   1/1  ----------------------------------------------------------------------
00473881   1/1  ----------------------------------------------------------------------
00472001   1/1  ----------------------------------------------------------------------
00488251   1/1  ----------------------------------------------------------------------
00477641   1/1  ----------------------------------------------------------------------
00491281   1/1  ----------------------------------------------------------------------
00490871   1/1  ----------------------------------------------------------------------
00470031   1/1  ----------------------------------------------------------------------
00460771   1/1  ----------------------------------------------------------------------
00480751   1/1  ----------------------------------------------------------------------
00518831   1/1  ----------------------------------------------------------------------
00410811   1/1  ----------------------------------------------------------------------
00458861   1/1  ----------------------------------------------------------------------
00458511   1/1  ----------------------------------------------------------------------
00459841   1/1  ----------------------------------------------------------------------
00533481   1/1  ----------------------------------------------------------------------
00457421   1/1  ----------------------------------------------------------------------
00489821   1/1  ----------------------------------------------------------------------
00510011   1/1  ----------------------------------------------------------------------
00465731   1/1  ----------------------------------------------------------------------
00490371   1/1  ----------------------------------------------------------------------
00467931   1/1  ----------------------------------------------------------------------
00466701   1/1  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           PAMTDNGMKVPTIFTASPYYLGTNDASAEKMMHSVDLPITRKEVKPLSYQDIEYHKPETKLPKKRPVVIS
00480031   1/1  Pkdtg...klPviltyspygkdinaplldpkllsevelvtfktadGlelhgylylpag....gkkpvvvl
00405821   1/1  ----------------------------------------------------------------------
00405811   1/1  ----------------------------------------------------------------------
00482071   1/1  ------------------------------------------------------lallllllltlllpal
00484601   1/1  -------------------------------------------------------------fklllllll
00410411   1/1  ----------------------------------------------------------------------
00397601   1/1  ----------------------------------------------------------------------
00411931   1/1  -----------------------------------------veveevtfksadgtklpgllylPpgadpg
00530451   1/1  ------------------------------------------------lPellslpgvtveevtvptpdg
00476831   1/1  ----------------------------------------------------dlppveevtvttpdGvrl
00486331   1/1  ---------------------------------------------lpveevtipspdgdrlplrlylPag
00489451   1/1  -----------------------------------------------------dlpgvpveevtiptpdG
00498871   1/1  ---------------------------------------eevrteiltldglrlyypp..gggklPvvvl
00479401   1/1  -------------------------vgllsldldllllsysslttpsdlylfddlllaelelllltalll
00502261   1/1  ------------------------------------------------dgmsepvtitseDglylnvtlt
00364431   1/1  ----------------------------------lpvetvtiptgdg.rlpaylylPag..agpapvvvl
00509471   1/1  ------------------------------------------epelvtfksrdgtelpgllylPagfdpg
00502451   1/1  -----------------------------------------------------asfsldldllllsyssp
00466391   1/1  rfkppepwsllgvldatllgplcpqllp......................................ppgv
00476011   1/1  --------------------------------------------lgllPvgelRfkaPvplepwpacpql
00480531   1/1  ------------------------------------------------pwsgvldlllllllllllllll
00416021   1/1  ----------------------------------------------------------------------
00395261   1/1  -------------------------------------------------------------mklllllll
00493831   1/1  ------------------------------------------llpipalyvvelvffstvdgdklplrvy
00476001   1/1  -----------------------------------------------------gllllllalllaslpsl
00458241   1/1  --------------------------------------------------Mrlylylpp..gggplpvvv
00496311   1/1  ----------------------------------------------------maldllvtvttpdGvrla
00473881   1/1  ---------------------------------allvpveevtvtv.dglrlayrlygppggpklpvvll
00472001   1/1  ---------------------------------------------dlellldisellkklgvpveevtvt
00488251   1/1  -------------------------------------lellsslkpfggvllkltvystadgrelsvyvy
00477641   1/1  -----------------------------lfdplllfdpevlldiselisklgypveevtvttedGltlp
00491281   1/1  ---------------------------------------------------alpvevetvtvpvdgdclh
00490871   1/1  -----------------------------------------------------PPyrpsg...ggpgppv
00470031   1/1  ------------------------------------------------------rlpallalllllaall
00460771   1/1  -----------------------------------elpfeertvtv.dglrlhyleag...pgdkppvvl
00480751   1/1  --------------------------------------------------rlhyrpag...egkppvvll
00518831   1/1  -------------------------------------llellslkpvpggtlevltfkstalgrerrvlv
00410811   1/1  -------------------------------------------------------------peegrfvtv
00458861   1/1  --------------------------------------------------------------lllllryw
00458511   1/1  -------------------------------------------lrllepllvpveertvttpdGlrlhyr
00459841   1/1  -------------------------------maa.lvpfeertvtv.dglrlhyreygp..psgppvvll
00533481   1/1  ------------------------------------------------------ery.pe....pgppvv
00457421   1/1  -----------------------------------------sefvtvdglrlhyreagp....gppvvll
00489821   1/1  ----------------------------------------------------llllllllllllllllll
00510011   1/1  --------------------------------------------------------------dgppvvll
00465731   1/1  -------------------------------------------------------lelepllnpveertv
00490371   1/1  -------------------------------------------lrllepllypfeeryvtvpdGlrlhyr
00467931   1/1  ------------------------------------------tvdglrlpyrlylpag..gggpkplvvl
00466701   1/1  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           TKNAEESWEHLFTYTFNDYMLARGFAVVYSGGVGTLDSDGYRTCGDEAETLGAKDVVEWLNGKRTAFTTK
00480031   1/1  lHGgpgssdrgsfrplaqylaarGyavvavdyrGsggsggpfdnygpdeveDllavidwlvkrggaftgr
00405821   1/1  ----------------------------------------------------------------------
00405811   1/1  ----------------------------------------------------------------------
00482071   1/1  lpppgvpveevtvptpdGvrlhyrlylPag..ggklPvvvllHGgggssgsagswrplaeaLaarGkpld
00484601   1/1  lllltlllpplppppgvpveevtvptpdGvrlhyrlygPpgggplPvvvllHGggfvsgvaalgsseswr
00410411   1/1  ----------------------------------------------------------------------
00397601   1/1  ----------------------------------------------------------------------
00411931   1/1  gkyPvvvllhGgggssgvpdsfsllplaqllasrGyvvvapdyrGsggsggafrdagpgnlgpad.veDl
00530451   1/1  vrlplrlylPag.pggklPvvvllHGgggssgsaswrplaralaarGyrvvapdyrggpehGfssgppgl
00476831   1/1  hyrlylPpg..ggplPvvvllHGgggssgswrplf.rslaraLaerGyrvvapDyrGhGgSggpp.ysge
00486331   1/1  yapggklPvvvllHGgggsseswalfgrplaralaaraGyavvapdyrGhgesggppadagsgnlglldl
00489451   1/1  vrlplrlylPagadpggklPvvvllHGgggssgspswrplaralaarlGyavvapdyrGhGesggpptpa
00498871   1/1  lHGgggsaeswrp..laealaerGyrvvapdyrghgesdgppdd......................ysle
00479401   1/1  pelfdlpgveveevtiptpdGvrlhyrlylP..dgggklPvvvllHGgggsseswr...plaraLaarGy
00502261   1/1  lpeispgpk.PvvvflHGGgfllgggsaesf..rplaralaarGllnvvvlvapdyrghgespgpag...
00364431   1/1  lhglggssasf..rplaralaarGyavlapdlrghglsggppdpalpldlgallallaaysldalvedle
00509471   1/1  kkyPvlvylhGgpgsqgvpnffsflllaqllasrGyvvvavdyrg..............sggsggaflda
00502451   1/1  ttppelylfldllllellllplltlldpllfdlpgveveevtiptpdGvrlpyrlylPpg.gggklPvvv
00466391   1/1  evedvtipgsdgrlplrlylPag.pggklPvvvflHGGgflggsaeswrp..laralaarlGyavvapdy
00476011   1/1  lslllpgllinkllekllrslldpepgvevedvtiptsdgrlylrlylP....ggplPvvvllHGGgflg
00480531   1/1  lllllllatkfgpacpqpvdlyppgvevedvtipspdgdprlplrlylPag.pggklPvvvflHGGgflg
00416021   1/1  ----------------------------------------------------------------------
00395261   1/1  lallllstagpagvtvetvtipsdggrlpgrlylPagadagklPvvvllhGlggsaesyrg..laralas
00493831   1/1  lpkgklPvvvllhGgggssgsaswspygg..laealaergyivvapdyrgggegflwpsssgppgnfgle
00476001   1/1  pggtveevtvtspvdgdtlplrvylPagydpggplPvvvllHGgggssgswslyrplaralaarliglgk
00458241   1/1  llHGgggsaeswrp..laealaerlpgyvvvapdyrggplgflgglqlfdllrghgespgpagll.....
00496311   1/1  yrlylPagagpkkgppvvllHGgggsseswrp..laeaLaarGyrVvapDlrGghGrsdglppdysledl
00473881   1/1  lHGlggsseswrplalaealaarGyrvvapdlrGhGlSdgppsllp....ysledlaadlaalldal...
00472001   1/1  tpdGvrlhyrlylpkpppppgggpgppvlllHGlggssgswldlgperglaeaLaerGyrVvapDlrGhG
00488251   1/1  lPpgalfsdsdpgkklPvlvllHGltgsaeswlektglaellaelGyavvapdlrgsgesgrpfeddawd
00477641   1/1  lylylpptygelgggpkppvlllHGlg.gsseswldlgperslaeaLaerGyrvvapdlrGhGgsagpys
00491281   1/1  l.vylPa..lP..avvvllhGgggsagsaslelyrglaralaarGyivvapdyrGfggsgpppad..gny
00490871   1/1  vllHGgggssesw..rplaealaerGyrviapdlrGhGgsdgpppd......ysledlaedlaalldall
00470031   1/1  aslpappggtveevtipsrdgdrplrvylPagydpggklPvvvllHGgggssgsalssldswrplaeala
00460771   1/1  lHGlgpGpgssesw..rplapaLae.gyrviapDlrGhGrSdgppsleysledl.vddlaadlealldal
00480751   1/1  HGlggsse....swrplapaLadgyrviapDlrGhGrSdppad..ysledlad.dllalld.........
00518831   1/1  ylPpgypgggyPvlvllhGlg.gsgrswapralaqllaaglipgyivvapdlrgsggssapydpadafld
00410811   1/1  dglrlhyrevgppdgkptvvllHGgpggss...gswrplipaLaegyrviapDlrGhGrSdpp.pgegyt
00458861   1/1  rdifdwltlepllvpfeefvtvsdglrlhyreygppdgppvvlllHGlggssesw...rplaeaLaarGy
00458511   1/1  eygppsgppvvllHGlggsseswr.....apaLaaalgyrviapDlrGhGrSdgppdlgdysledlad.d
00459841   1/1  HGlggsse....swrplapaLaegyrviapDlrGhGrSdgpp......pdysledladdlaalldal...
00533481   1/1  llHGlggsaeswwlpsswrpla.eaLaeaGyrviapdlrGhGgSdgpp........ysledlaedlaall
00457421   1/1  HGlggssesw...rplaeaLaerGyrviapDlrGhGlSdgppsd......ysledladdlaalldal...
00489821   1/1  vlllllllkllepllnpveertvtvdglrlhyrlygp....gdgppvvllHGlggsses...wrpltgpg
00510011   1/1  HGlggssesw...rplapaLaerGyrviapDlrGhGrSdgppsplysledlad.dlaalldal.......
00465731   1/1  tvgdGlrlhyreagpgppvvllHGlggsse.swrpla.....eaLaeaGyrviapDlrGhGrSdgppspy
00490371   1/1  eygppsgppvlllHGlggssesw....plapaLaeagyrviapDlrGhGrSdgp....pdlgdysledla
00467931   1/1  lHGlggsgadwrp..laralaeagfrvvapdypghgespnpgaggrawfdilalspggpedeagledaae
00466701   1/1  ------sspggpvveesvtstvdgdrlplrvylPagagPvvvllHGgggsagspswrnyg..glaealae


                         -         -         -         -         *         -         -:420
query           EANKAIPAWWSNGKVAMTGKSYLGTLATAAATTGVAGLETIISEAAISSWYDYYREGGLVIAPGGFPGED
00480031   1/1  tggkeakqpwdngkvgllGhSyGGylalllaarypdrlkalvllagvsdlyrdyrehggillpgglpged
00405821   1/1  ----------------------------------------------------------------------
00405811   1/1  ----------------------------------------------------------------------
00482071   1/1  tdrvyrVvapDyrGhGgSdgpapeapytllgwgfsledlaeDlaaaldwlren.............fgi.
00484601   1/1  plggnsaraLaarGyrVvapDyrGhGeSlgpegplslgddflggfgedaadDlaaaldwlren.......
00410411   1/1  ----------------------------------------------------------------------
00397601   1/1  ----------------------------------------------------------------------
00411931   1/1  iaaldylral..............ggvdpdriallGhSyGGylalalaarypdlfkaavalspvldllly
00530451   1/1  adggdll.................aedlaaaldwllengidprvvlvGhSmGGalalalalrypdrvkal
00476831   1/1  dladDlaaaldalrenlgi..................d.ervvlvGhSmGGalalalaaryPdrvkglvl
00486331   1/1  edlaaaldallda...........lgidpervvlvGhSmGGalalalalrypdrvkalvllspaldltal
00489451   1/1  gaaysgedlaeDlaaaldwlren..............fgidpdrvvlvGhSmGGalalalalrypdrvka
00498871   1/1  dlaedllaaldwlreniavfggllllldpl.rvvlvGhSmGGalalalalrypd.vkalvllspaldlla
00479401   1/1  rvvapdyrGhGesgg.ppadysledlgfyddeqakpyglhfpmvadDlaaaldwlren...........f
00502261   1/1  ...ledlaaaldwlldn................ldpdrivlvGhSaGGalalalalrypdrglpllllll
00364431   1/1  aaldylraq.............p..vdagkvglvGhSlGGalallla..apdrvkalvllagaldl....
00509471   1/1  grgnlggveldDlvaaldwlleqggvDpdriaifGhSyGGylalalalalldrypdrfkaavalapvtdl
00502451   1/1  llHGggg..sseswrp..araLaarGyrvvapDyrGhGrSsppaslngalgfasggdfpaatlgdlggve
00466391   1/1  rghgesgg......pagledlaaaldwllenlaal...........gidpdrivlvGhSaGGalalalal
00476011   1/1  gsadswrp..laralaarlGyavvapdyrghgesggp......aaledlaaaldwllenldal.......
00480531   1/1  gsaesw..rplaralaarlGyavvapdyrghgesgg......paaledlaaaldwllenldal.......
00416021   1/1  ----------------------------------------------------------------------
00395261   1/1  rGyavvapDlrghgespgpp.......................vedllaaldyllallearlgvDpdrig
00493831   1/1  dlldalaedlidlleak..............lgidpervalvGhSmGGllalalalrypdlfkgvillsp
00476001   1/1  lpgyvvvapdyrGhgesggp..aagndgeddaedllalldali.rf...........ggdpdrvalvGhS
00458241   1/1  .........ysledlaadllalldalaelgldpdriglvGhSmGGalalalaslrypdrfkalvllspal
00496311   1/1  aeDlaalldalreq.................gpervvlvGhSmGGllalalaaryp..vkglvllsppld
00473881   1/1  ..........glervvlvGhSmGGllalllaarypervkglvllspaldllal.................
00472001   1/1  rStgpgflddgpgdpgdysledlaeaDlaaaidyllda.............lgiekvvlvGhSmGGllal
00488251   1/1  fgggagfyvnatedplakrgrmedylvedlpalidalfpvlaerggidldrvaiaGhSmGGygAlalalr
00477641   1/1  lgpapgepgdy.sledlavddlaaaldylrer................lgiekvvlvGhSmGGllalaaa
00491281   1/1  glldqlaaaaldwlran..............lgidpgrvvlvGhSlGGalalllalryPdlvaglvllsg
00490871   1/1  el..........gpekvvlvGhSmGGllalalaaryp..vkglvllspaldlsa..........lpllle
00470031   1/1  arGdlppyrvvap..............pgpygledlaaaldwlldellginiaafgtlaerlllklgdpe
00460771   1/1  .............gidkvvlvGhSmGGlialalaarypervkglvllspalpl.ppllplllarllalll
00480751   1/1  ............epvvlvGhSmGGlialalaarypervkglvllapapplldlaellarllkalaallal
00518831   1/1  flaeellpll............dalypvgadpdrvvlaGhSmGGllAlylalryPerfagvvalsgslwp
00410811   1/1  lddladdlealldal................lglekvvlvGhSmGGalalayAaryPdrvkglvllgpag
00458861   1/1  rviapDlrGhGrSdgppspadysledlad.dlaalldal.................giepvvlvGhSmGG
00458511   1/1  laalldal.................giekvvlvGhSmGGllalalaaryPervkglvllspplplsalad
00459841   1/1  ..........giepvvlvGhSmGGlvalalaary...Pervkglvllspplplsaladaalllllllaal
00533481   1/1  dal.............giekvvlvGhSmGGlvalelaarypervkglvllappldgspladallellrka
00457421   1/1  ..........glepvvlvGhSmGGlvalaYlaarypervkglvllsppapladladplaglllarllaal
00489821   1/1  pglaeaLaarGyrViapDlrGhGrStgpvsldpgtgkgyyvdatlplllllglglewsllrfdgppgdgg
00510011   1/1  ..........gidekvvlvGhSmGGlialalaary...pervkglvllapppplsaladallrllllall
00465731   1/1  pysledlad.dlaalldal.................glepvvlvGhSmGGllalalaaryPervkglvll
00490371   1/1  adlaalldal.............giekvvlvGhSmGGlialalaaryPervkglvllapalplseladwl
00467931   1/1  dlaalidallrlgidperivlvGfSmGGalalllalrlpdrvaglvllsgalplaallp...........
00466701   1/1  rGyivvapdyRgggflrghgdsdgppgn...fglldiedaladel...........idalidalgidper


                         -         -         +         -         -         -         -:490
query           ADILAEECFSRQKSAGDYNHSKDGFNKFLSTITKDQDRTTGNYNTFWDARNYLKDVGNIKCDIVMVHGLN
00480031   1/1  ldvlaaalysrlllpgdllkleeayekllaellparyrahplyddfwrdrsplenldkikvPvLiihGla
00405821   1/1  ----------------------------------------------------------------------
00405811   1/1  ----------------------------------------------------------------------
00482071   1/1  dpervvlvGhSmGGalalalaaryPdrvkglvllspaldllpldpallerlllallgdllaallallall
00484601   1/1  .......lgidpervvlvGhSmGGalalalaarlyPd.vkglvllspaldllpadlpsleralldalldd
00410411   1/1  ----------------------------------------------------------------------
00397601   1/1  ----------------------------------------------------------------------
00411931   1/1  dtayterylglpllpedpealka...........................................yspl
00530451   1/1  vllspaldlaallpsllelllllllllllll.......................................
00476831   1/1  lspaldlllddlllpggapllplllalllgdlaalllallrllleallrllaallllsplladlsylrll
00486331   1/1  ala...........................................lllleaglgllpellealraydpl
00489451   1/1  lvllspaldllalllsllllll.......................................lleallgll
00498871   1/1  lllalllllll..................................................lalllaydp
00479401   1/1  gidpervvlvGhSmGGalalala.rypdrvkglvllspaldlaa..........................
00502261   1/1  dllsllsrvkalvlispvldllalllslll........................................
00364431   1/1  ..................................................................dple
00509471   1/1  lly.............................................dsgylerylglpeenpeayday
00502451   1/1  nallrllaeDlaaaldwlren...........fgidpervvlvGhSmGGalalalaarypd.vkalvlls
00466391   1/1  rypdrglprvaalvllspvldlpa......................sldlpslreladgpllppallerl
00476011   1/1  ....gidpdrvvlvGhSaGGalalalalrypdrglprvaalvllspaldll...................
00480531   1/1  ....gidpdrvvlvGhSaGGalalalalrypdrglplvaalvllspvldl....................
00416021   1/1  ----------------------------------------------------------------------
00395261   1/1  lvGhSmGGalalllaardpd.vkavvllapvldl....................................
00493831   1/1  aldlsdlals....................................ellelllkelgekgvprllgnvyl
00476001   1/1  mGGalalalalrypdrvkalvllspaldllalalallllal.............................
00458241   1/1  dlldlllsllllll........................................................
00496311   1/1  lsalalallrllllll..............................................lppefled
00473881   1/1  ....................................................lealakikvPvlvihged
00472001   1/1  alaaryPelgdrvkglvllsppldlsdlaepllallaalllllaallgllgalllallarallalllgdl
00488251   1/1  llypdrfkavvalspvvnpsll..............................................pw
00477641   1/1  arlpelgervkglvllappldls.plaepllrlllalllfldgllgllgllpgellagalrllrpddlsl
00491281   1/1  plpgsaaala..............................elpeallallggldlelllg.pvllgdlll
00490871   1/1  allkrlldrllgdelldlllladplllarllldlladllalle.........dllealakikvPvliihG
00470031   1/1  rvdrvlvGhSmGGalalalalry...Pdrvkalvllspald.............................
00460771   1/1  allleallelllrlllspdpltldpelleallrlllapgalaalaallrlllsaldlyadllealkkikv
00480751   1/1  llllleallkrlllllllglllddelaelllallralgtadllallellralrradllealkkikvPvlv
00518831   1/1  sdgplg........................................................dpealrey
00410811   1/1  llplellalllllllllpallaallaallallladllaalllrllfpdallrdpelvaelledllrasgl
00458861   1/1  llalalaaryPervkglvllspplplsalapallrllaalllalllalllallrelllrlllllaallag
00458511   1/1  allllarqallpdllaallallpagllaalleallrllallaflsdealleallrllalylalltdpeal
00459841   1/1  larllellgalspeellellarllladlldpelleaylrllladgalraalalyrlllealdlsdlalar
00533481   1/1  llalllkllgllpe..................................lllllallrrldllealkkikv
00457421   1/1  lalllallpelllrlllelllpllladaelleal......lrylldlllradlrallallralaradlle
00489821   1/1  aglvysledl.aedlaalltdalrartgvllllanaeslgiglervvlvGhSmGGavalllaaryPervk
00510011   1/1  lllllllllyllllllllgglallltdpellalllalllagfarallallaglldalallaeadllealk
00465731   1/1  spplplsapldallealakllaslpdllfllggllelllplspaallrlladlplglaallaekfgrwlg
00490371   1/1  lrllakallepllllllalllalllallleallellladlllsddlaalllllllllsdlrlspeallal
00467931   1/1  ......................................................dllellaklkvPvlli
00466701   1/1  valvGhSmGGllalalalryPdlfkalvllspaldl..................................


                         *         -         -         -         -         +         -:560
query           DWNVKLKNVFNLYNKLGDVEVTKKLILHQGQHIYINNFQSLDFTDMMNLWLSHKLYGVENNAKELLPDIL
00480031   1/1  Dtlvppeqalrlyealpe.gnpkllilpgagHgfpnpenpeefleailafldeyLkgedngaed.lppvr
00405821   1/1  ----------------------------------------------------------------------
00405811   1/1  ----------------------------------------------------------------------
00482071   1/1  lddlpealaallagllallllralaaalagllraldsldglpelldylraadpledlaklpikvPvliih
00484601   1/1  llpllllrllladaallppelldallaslllldslaallrfdanaflgllgaldad.dylraydpledla
00410411   1/1  ----------------------------------------------------------------------
00397601   1/1  ----------------------------------------------------------------------
00411931   1/1  eladkikpppvllihGtaDdvvppeqsealadalkeagvpvelllypgagHgflk---------------
00530451   1/1  ..laallaldplellakikvPvliihGedDplvppedaealaealpaagvpvelvvipgagHlg------
00476831   1/1  alrllaafdnfllalllalrllddyyregdpledlakikvPvliihGedDplvp.esaealaallp..ga
00486331   1/1  ellakikavPvliihGedDplvppeeaealaealpaagvpvelvvipgagHgflf---------------
00489451   1/1  pellealraysplellkllllakikvPpvliihGedDplvppeeaealaealpel---------------
00498871   1/1  lellkkiakvPvliihGedDplvppeeaealaealkaagpnvelvvillpgagHg---------------
00479401   1/1  .....lllpeallallrallldeflraglptlrellealraydpledlakikv-----------------
00502261   1/1  ....lrkflleylggdlaedlelllaaspllaedlkkikvPvliihGedDpl------------------
00364431   1/1  dlakikvPvliihGedDplvppelaealaealka.gpdvellvypgagHgfflee---------------
00509471   1/1  splehadklkltplllihGtaDdvvppqqsealaaalkaagvpvellvypgegHg---------------
00502451   1/1  paldls.................................rlllgllpalllr------------------
00466391   1/1  lgallgdpad........lldplasplealdkikvPpvliihGedD..vppdeaeal-------------
00476011   1/1  .....alapslaellggdpllppellerlrallledlaa......lllplas------------------
00480531   1/1  ....eellpsylellggppldpelleafld----------------------------------------
00416021   1/1  ----------------------------------------------------------------------
00395261   1/1  .....................................edlakikvPtlvihgeaD---------------
00493831   1/1  eylraydpldllkklakikppvliihGekDlipllggdllgeflevvppeeaeklaea------------
00476001   1/1  ..................................lakikvPvliiAhGeaDplvp..eaealaealpa--
00458241   1/1  ...........kvPvliihGekDplvppeeaealaealpaagvdvelvvypa------------------
00496311   1/1  llalfdeelrdlllgllrallalaeadpledlakikvPvliihGedDplvppeda---------------
00473881   1/1  Dplvppel..alaealpnael...vvlpgagHfllle.apeevaeaildfldrl----------------
00472001   1/1  llealvaellalllgldpalldllaldallaalparlllellrklldlfdengll---------------
00488251   1/1  gqkafegylgddkeaweaydplellkklkglplppvllihGtaDplvppelspea---------------
00477641   1/1  eelvakllrlllggdapafdllaldadltglpagtsldellhllqlfdend-------------------
00491281   1/1  ldpldlledlkaikvpvliihGedDpvvpp----------------------------------------
00490871   1/1  edDplvppedaeelaealpgadvelvvipgagHflfleap.reevaeaildfl-----------------
00470031   1/1  ........................glgllledlaallaasplellakikvPv------------------
00460771   1/1  PvlvihGedDplvppeaaeelaellpna...elvvipgagHflfle.apeeva-----------------
00480751   1/1  ihGedDplvppeaaeelaellpna...elvvipgagHflfle.apeevaeail.flk-------------
00518831   1/1  dplellaklkvpvllihGteDglvppe.aralaealpaagipvelvelpgghhwpv.-------------
00410811   1/1  aaalalllllyllllaalarldllerlakikvPtLiihGedDpvvp.egar-------------------
00458861   1/1  lspelleallalllapgalradlallrallgfldlddyyrrasllealaki-------------------
00458511   1/1  lallealraglflrldygyllndllygsradllealakikdvPvlvihGed-------------------
00459841   1/1  adllealakikvPvlvihGedDplvppeaaeelaellpn...aelvvipgagHflfle.apeevae----
00533481   1/1  lttegallfnakyPnggl----------------------------------------------------
00457421   1/1  alakikvPvlvihGedDplvppeaaealaealk..pnaelvvipgagHflfle-----------------
00489821   1/1  glvllspald...........................................-----------------
00510011   1/1  kikvPvlvihGedDplvppeaaeelaellpn...aelvvipgagHflfle.ap-----------------
00465731   1/1  fdveslldnqgsallddelldallrlllrpd.fraalrllra............----------------
00490371   1/1  ldalsalslaraplngyrnalfyyeradllealkkikkvPvliihGedDplvppeda-------------
00467931   1/1  hGeaDpvvppeaaralaealpaagvskdvelvvypgagHgfp.....leapeevl---------------
00466701   1/1  ...ladllpflerllkallgekglpaylgpivpeallaysplellkkliankppvl--------------


                         -         -         -         *         -         -         -:630
query           VQNNTKESTWETYSSWQSKNFTKLYLNSDSLSAQKKENQTLEFSDHLPETTFKHYQTDIANWKEEILAST
00480031   1/1  i.fllganrwrsedeW------------------------------------------------------
00405821   1/1  -----------------------ltfggsnllllglgtglasftddldeelfelygidlevfekdllsgk
00405811   1/1  ----------------------------------------------------------------------
00482071   1/1  GedD.lvppedaeala------------------------------------------------------
00484601   1/1  kikglvPvliihGedD------------------------------------------------------
00410411   1/1  ---------wrwfddWlldgtpllrlylgggllltpsppadsgpdryvydparPvptlgglaglalglll
00397601   1/1  ------pgrwralddWplpgtelrrlylgdgglltsppadggadvyvydPlrpvptlggallllllpelp
00411931   1/1  ----------------------------------------------------------------------
00530451   1/1  ----------------------------------------------------------------------
00476831   1/1  pvllvipgggHg.lfl------------------------------------------------------
00486331   1/1  ----------------------------------------------------------------------
00489451   1/1  ----------------------------------------------------------------------
00498871   1/1  ----------------------------------------------------------------------
00479401   1/1  ----------------------------------------------------------------------
00502261   1/1  ----------------------------------------------------------------------
00364431   1/1  ----------------------------------------------------------------------
00509471   1/1  ----------------------------------------------------------------------
00502451   1/1  ----------------------------------------------------------------------
00466391   1/1  ----------------------------------------------------------------------
00476011   1/1  ----------------------------------------------------------------------
00480531   1/1  ----------------------------------------------------------------------
00416021   1/1  -----gldsW....plpgatlrrlyLspdggllaeapaag.gadvyvydPldpvpalggllslagglllg
00395261   1/1  ----------------------------------------------------------------------
00493831   1/1  ----------------------------------------------------------------------
00476001   1/1  ----------------------------------------------------------------------
00458241   1/1  ----------------------------------------------------------------------
00496311   1/1  ----------------------------------------------------------------------
00473881   1/1  ----------------------------------------------------------------------
00472001   1/1  ----------------------------------------------------------------------
00488251   1/1  ----------------------------------------------------------------------
00477641   1/1  ----------------------------------------------------------------------
00491281   1/1  ----------------------------------------------------------------------
00490871   1/1  ----------------------------------------------------------------------
00470031   1/1  ----------------------------------------------------------------------
00460771   1/1  ----------------------------------------------------------------------
00480751   1/1  ----------------------------------------------------------------------
00518831   1/1  ----------------------------------------------------------------------
00410811   1/1  ----------------------------------------------------------------------
00458861   1/1  ----------------------------------------------------------------------
00458511   1/1  ----------------------------------------------------------------------
00459841   1/1  ----------------------------------------------------------------------
00533481   1/1  ----------------------------------------------------------------------
00457421   1/1  ----------------------------------------------------------------------
00489821   1/1  ----------------------------------------------------------------------
00510011   1/1  ----------------------------------------------------------------------
00465731   1/1  ----------------------------------------------------------------------
00490371   1/1  ----------------------------------------------------------------------
00467931   1/1  ----------------------------------------------------------------------
00466701   1/1  ----------------------------------------------------------------------


                         -         +         -         -         -         -         *:700
query           SPKLETNRLILTSKPLKHETLLKGVAKIKLKIASQLDHGLVSVKLVDYGDAKRLGATPTILERRGLDLGY
00480031   1/1  ----------------------------------------------------------------------
00405821   1/1  ......nrlifetlpltedlllnGtpklslrvksstnkglLsalLvdlgpdkrltelpkilalksldlGi
00405811   1/1  ----------------------------------------------------------------------
00482071   1/1  ----------------------------------------------------------------------
00484601   1/1  ----------------------------------------------------------------------
00410411   1/1  gpegpadqraldsrgdvltfttapLtedleilGapvveLrvssdapdadlvvkLsdvaPdgr....stll
00397601   1/1  adqrlldgrsdvltfttapLtedleitGlpvarLlvssdapdadlfvkLsdvdpd...Gks.........
00411931   1/1  ----------------------------------------------------------------------
00530451   1/1  ----------------------------------------------------------------------
00476831   1/1  ----------------------------------------------------------------------
00486331   1/1  ----------------------------------------------------------------------
00489451   1/1  ----------------------------------------------------------------------
00498871   1/1  ----------------------------------------------------------------------
00479401   1/1  ----------------------------------------------------------------------
00502261   1/1  ----------------------------------------------------------------------
00364431   1/1  ----------------------------------------------------------------------
00509471   1/1  ----------------------------------------------------------------------
00502451   1/1  ----------------------------------------------------------------------
00466391   1/1  ----------------------------------------------------------------------
00476011   1/1  ----------------------------------------------------------------------
00480531   1/1  ----------------------------------------------------------------------
00416021   1/1  plgpldqreldsrgdvltfttepLtedleilGapvveLlvssdapdadlvvkLsdvlPdgtstlvsqgvl
00395261   1/1  ----------------------------------------------------------------------
00493831   1/1  ----------------------------------------------------------------------
00476001   1/1  ----------------------------------------------------------------------
00458241   1/1  ----------------------------------------------------------------------
00496311   1/1  ----------------------------------------------------------------------
00473881   1/1  ----------------------------------------------------------------------
00472001   1/1  ----------------------------------------------------------------------
00488251   1/1  ----------------------------------------------------------------------
00477641   1/1  ----------------------------------------------------------------------
00491281   1/1  ----------------------------------------------------------------------
00490871   1/1  ----------------------------------------------------------------------
00470031   1/1  ----------------------------------------------------------------------
00460771   1/1  ----------------------------------------------------------------------
00480751   1/1  ----------------------------------------------------------------------
00518831   1/1  ----------------------------------------------------------------------
00410811   1/1  ----------------------------------------------------------------------
00458861   1/1  ----------------------------------------------------------------------
00458511   1/1  ----------------------------------------------------------------------
00459841   1/1  ----------------------------------------------------------------------
00533481   1/1  ----------------------------------------------------------------------
00457421   1/1  ----------------------------------------------------------------------
00489821   1/1  ----------------------------------------------------------------------
00510011   1/1  ----------------------------------------------------------------------
00465731   1/1  ----------------------------------------------------------------------
00490371   1/1  ----------------------------------------------------------------------
00467931   1/1  ----------------------------------------------------------------------
00466701   1/1  ----------------------------------------------------------------------


                         -         -         -         -         +         -         -:770
query           HWKEDNLVEFKLAKETPFKMITQAHLNLQNRHNDFSTDELEANKFYDVEITTQPMFYHLPKGHKLGLVIY
00480031   1/1  ----------------------------------------------------------------------
00405821   1/1  nfseddlrelpl.ketpakliTkGhlnlqnr.dlltvedlvpgkfydlkleLqPtiyklekGhrLrLvly
00405811   1/1  ----------------------------------------------------------------------
00482071   1/1  ----------------------------------------------------------------------
00484601   1/1  ----------------------------------------------------------------------
00410411   1/1  segilrlslr.....................lgilrprhreslekpeplepgevyevtvdLqptahrfrk
00397601   1/1  ......................tllslGilrlshresdedpeplepgevveveveLqptghvfrkGhrlr
00411931   1/1  ----------------------------------------------------------------------
00530451   1/1  ----------------------------------------------------------------------
00476831   1/1  ----------------------------------------------------------------------
00486331   1/1  ----------------------------------------------------------------------
00489451   1/1  ----------------------------------------------------------------------
00498871   1/1  ----------------------------------------------------------------------
00479401   1/1  ----------------------------------------------------------------------
00502261   1/1  ----------------------------------------------------------------------
00364431   1/1  ----------------------------------------------------------------------
00509471   1/1  ----------------------------------------------------------------------
00502451   1/1  ----------------------------------------------------------------------
00466391   1/1  ----------------------------------------------------------------------
00476011   1/1  ----------------------------------------------------------------------
00480531   1/1  ----------------------------------------------------------------------
00416021   1/1  ellvsdgilrlshre..............................sledpeplepgevlevtvdLqptah
00395261   1/1  ----------------------------------------------------------------------
00493831   1/1  ----------------------------------------------------------------------
00476001   1/1  ----------------------------------------------------------------------
00458241   1/1  ----------------------------------------------------------------------
00496311   1/1  ----------------------------------------------------------------------
00473881   1/1  ----------------------------------------------------------------------
00472001   1/1  ----------------------------------------------------------------------
00488251   1/1  ----------------------------------------------------------------------
00477641   1/1  ----------------------------------------------------------------------
00491281   1/1  ----------------------------------------------------------------------
00490871   1/1  ----------------------------------------------------------------------
00470031   1/1  ----------------------------------------------------------------------
00460771   1/1  ----------------------------------------------------------------------
00480751   1/1  ----------------------------------------------------------------------
00518831   1/1  ----------------------------------------------------------------------
00410811   1/1  ----------------------------------------------------------------------
00458861   1/1  ----------------------------------------------------------------------
00458511   1/1  ----------------------------------------------------------------------
00459841   1/1  ----------------------------------------------------------------------
00533481   1/1  ----------------------------------------------------------------------
00457421   1/1  ----------------------------------------------------------------------
00489821   1/1  ----------------------------------------------------------------------
00510011   1/1  ----------------------------------------------------------------------
00465731   1/1  ----------------------------------------------------------------------
00490371   1/1  ----------------------------------------------------------------------
00467931   1/1  ----------------------------------------------------------------------
00466701   1/1  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:840
query           ATDMEMTLQGNEENSYRIDTTGSYCLLPIEE---------------------------------------
00480031   1/1  ----------------------------------------------------------------------
00405821   1/1  stDfeltirpnedttltvdlakssltlPles---------------------------------------
00405811   1/1  ----------------------------------------------------------------------
00482071   1/1  ----------------------------------------------------------------------
00484601   1/1  ----------------------------------------------------------------------
00410411   1/1  GhrlrlsisssdfPlydrnpgtgtltldla----------------------------------------
00397601   1/1  lsvsssdfplylrnpgtgllllldrlaellva--------------------------------------
00411931   1/1  ----------------------------------------------------------------------
00530451   1/1  ----------------------------------------------------------------------
00476831   1/1  ----------------------------------------------------------------------
00486331   1/1  ----------------------------------------------------------------------
00489451   1/1  ----------------------------------------------------------------------
00498871   1/1  ----------------------------------------------------------------------
00479401   1/1  ----------------------------------------------------------------------
00502261   1/1  ----------------------------------------------------------------------
00364431   1/1  ----------------------------------------------------------------------
00509471   1/1  ----------------------------------------------------------------------
00502451   1/1  ----------------------------------------------------------------------
00466391   1/1  ----------------------------------------------------------------------
00476011   1/1  ----------------------------------------------------------------------
00480531   1/1  ----------------------------------------------------------------------
00416021   1/1  rfrkGhrirlsvsssdfPlylrnPgtgvpll---------------------------------------
00395261   1/1  ----------------------------------------------------------------------
00493831   1/1  ----------------------------------------------------------------------
00476001   1/1  ----------------------------------------------------------------------
00458241   1/1  ----------------------------------------------------------------------
00496311   1/1  ----------------------------------------------------------------------
00473881   1/1  ----------------------------------------------------------------------
00472001   1/1  ----------------------------------------------------------------------
00488251   1/1  ----------------------------------------------------------------------
00477641   1/1  ----------------------------------------------------------------------
00491281   1/1  ----------------------------------------------------------------------
00490871   1/1  ----------------------------------------------------------------------
00470031   1/1  ----------------------------------------------------------------------
00460771   1/1  ----------------------------------------------------------------------
00480751   1/1  ----------------------------------------------------------------------
00518831   1/1  ----------------------------------------------------------------------
00410811   1/1  ----------------------------------------------------------------------
00458861   1/1  ----------------------------------------------------------------------
00458511   1/1  ----------------------------------------------------------------------
00459841   1/1  ----------------------------------------------------------------------
00533481   1/1  ----------------------------------------------------------------------
00457421   1/1  ----------------------------------------------------------------------
00489821   1/1  ----------------------------------------------------------------------
00510011   1/1  ----------------------------------------------------------------------
00465731   1/1  ----------------------------------------------------------------------
00490371   1/1  ----------------------------------------------------------------------
00467931   1/1  ----------------------------------------------------------------------
00466701   1/1  ----------------------------------------------------------------------