[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for lsal0:ABE00427.1


[Show Plain Result]

## Summary of Sequence Search
   1::248
   4::226  5.5e-70 39.8% 0039041 00390411 1/1   p containing nucleoside triphosphate hy 
   1::240  1.3e-69 39.7% 0050943 00509431 1/1   p containing nucleoside triphosphate hy 
   2::226  1.4e-66 43.3% 0036790 00367901 1/1   p containing nucleoside triphosphate hy 
   1::231    6e-65 43.4% 0037958 00379581 1/1   p containing nucleoside triphosphate hy 
   2::226  5.6e-64 45.4% 0042280 00422801 1/1   p containing nucleoside triphosphate hy 
   1::240  1.2e-63 43.0% 0037898 00378981 1/1   p containing nucleoside triphosphate hy 
   1::244  2.5e-63 46.6% 0036121 00361211 1/1   p containing nucleoside triphosphate hy 
   1::237  3.7e-63 42.8% 0044086 00440861 1/1   p containing nucleoside triphosphate hy 
   1::232  5.8e-63 42.6% 0047589 00475891 1/1   p containing nucleoside triphosphate hy 
   1::242  2.1e-62 41.6% 0050044 00500441 1/1   p containing nucleoside triphosphate hy 
   1::241  3.1e-62 44.9% 0042070 00420701 1/1   p containing nucleoside triphosphate hy 
   2::241  7.7e-61 43.7% 0042557 00425571 1/1   p containing nucleoside triphosphate hy 
   1::244  1.5e-60 40.4% 0048220 00482201 1/1   p containing nucleoside triphosphate hy 
   2::232  1.9e-60 42.3% 0049080 00490801 1/1   p containing nucleoside triphosphate hy 
   6::226  5.5e-60 40.6% 0046693 00466931 1/1   p containing nucleoside triphosphate hy 
   2::232  5.6e-60 42.3% 0051025 00510251 1/1   p containing nucleoside triphosphate hy 
   2::245  1.9e-59 42.9% 0050274 00502741 1/1   p containing nucleoside triphosphate hy 
   3::239  3.2e-59 44.2% 0040410 00404101 1/1   p containing nucleoside triphosphate hy 
   2::245  4.6e-59 40.4% 0048226 00482261 1/1   p containing nucleoside triphosphate hy 
   1::227  1.5e-58 41.8% 0046697 00466971 1/1   p containing nucleoside triphosphate hy 
   1::232  1.5e-58 41.8% 0047599 00475991 1/1   p containing nucleoside triphosphate hy 
   1::232  2.7e-58 41.3% 0053059 00530591 1/1   p containing nucleoside triphosphate hy 
   2::230  4.7e-58 41.4% 0045860 00458601 1/1   p containing nucleoside triphosphate hy 
   1::230  8.1e-57 41.3% 0049537 00495371 1/1   p containing nucleoside triphosphate hy 
   1::214  1.3e-56 47.0% 0043607 00436071 1/1   p containing nucleoside triphosphate hy 
   9::232  1.1e-54 43.0% 0048545 00485451 1/1   p containing nucleoside triphosphate hy 
   1::227  1.9e-54 40.2% 0042496 00424961 1/1   p containing nucleoside triphosphate hy 
   1::230  4.3e-54 43.1% 0050061 00500611 1/1   p containing nucleoside triphosphate hy 
   1::229  1.6e-53 45.4% 0037230 00372301 1/1   p containing nucleoside triphosphate hy 
   1::235  1.6e-53 48.7% 0046945 00469451 1/1   p containing nucleoside triphosphate hy 
   1::233  1.8e-52 40.3% 0049825 00498251 1/1   p containing nucleoside triphosphate hy 
   1::228    2e-52 43.0% 0048852 00488521 1/1   p containing nucleoside triphosphate hy 
   4::226  1.1e-51 47.6% 0049611 00496111 1/1   p containing nucleoside triphosphate hy 
   1::228  1.7e-51 41.4% 0036748 00367481 1/1   p containing nucleoside triphosphate hy 
   1::209  4.2e-51 41.6% 0043651 00436511 1/1   p containing nucleoside triphosphate hy 
   1::232  1.5e-50 43.9% 0046869 00468691 1/1   p containing nucleoside triphosphate hy 
   1::227  2.2e-49 45.2% 0042214 00422141 1/1   p containing nucleoside triphosphate hy 
   1::230  7.6e-49 40.6% 0037960 00379601 1/1   p containing nucleoside triphosphate hy 
   1::228  5.7e-48 40.0% 0049503 00495031 1/1   p containing nucleoside triphosphate hy 
  25::227  7.6e-48 47.0% 0045731 00457311 1/1   p containing nucleoside triphosphate hy 
  10::229  5.9e-47 36.4% 0050337 00503371 1/1   p containing nucleoside triphosphate hy 
  14::242  2.5e-46 40.0% 0053253 00532531 1/1   arboxykinase-like                       
  17::237  8.5e-45 40.9% 0044893 00448931 1/1   p containing nucleoside triphosphate hy 
   1::229  9.1e-45 43.3% 0043798 00437981 1/1   p containing nucleoside triphosphate hy 
  22::236  1.7e-44 38.5% 0048593 00485931 1/1   p containing nucleoside triphosphate hy 
  27::186  5.6e-43 47.6% 0038144 00381441 1/1   p containing nucleoside triphosphate hy 
  14::189  1.7e-42 50.6% 0047552 00475521 1/1   arboxykinase-like                       
  12::205  1.1e-41 44.6% 0047841 00478411 1/1   arboxykinase-like                       
  19::237  4.6e-41 36.1% 0046860 00468601 1/1   p containing nucleoside triphosphate hy 
   1::241  3.7e-40 35.1% 0037163 00371631 1/1   p containing nucleoside triphosphate hy 
  25::242  1.5e-39 37.5% 0041412 00414121 1/1   p containing nucleoside triphosphate hy 
   1::222  1.8e-37 42.0% 0046479 00464791 1/1   p containing nucleoside triphosphate hy 
  26::190  6.5e-37 44.1% 0051551 00515511 1/1   p containing nucleoside triphosphate hy 
   4::198  9.3e-37 40.3% 0035641 00356411 1/1   p containing nucleoside triphosphate hy 
  26::193  7.9e-36 44.5% 0051553 00515531 1/1   p containing nucleoside triphosphate hy 
  11::228  1.2e-35 36.9% 0046276 00462761 1/1   p containing nucleoside triphosphate hy 
  25::212  1.8e-35 42.5% 0047797 00477971 1/1   p containing nucleoside triphosphate hy 
  16::220  9.7e-35 34.6% 0047537 00475371 1/1   p containing nucleoside triphosphate hy 
  25::218  1.5e-34 44.3% 0042605 00426051 1/1   p containing nucleoside triphosphate hy 
   2::230  1.1e-33 33.9% 0036850 00368501 1/1   p containing nucleoside triphosphate hy 
  12::201  5.8e-33 39.9% 0047844 00478441 1/1   arboxykinase-like                       
  21::172  1.1e-31 43.2% 0048047 00480471 1/1   p containing nucleoside triphosphate hy 
  27::176  2.6e-29 40.8% 0047538 00475381 1/1   p containing nucleoside triphosphate hy 
  27::247    6e-29 33.5% 0053350 00533501 1/1   p containing nucleoside triphosphate hy 
   1::223    8e-29 29.0% 0051056 00510561 1/1   p containing nucleoside triphosphate hy 
  18::197  8.4e-29 42.0% 0050867 00508671 1/1   p containing nucleoside triphosphate hy 
  28::226    1e-28 30.9% 0051289 00512891 1/1   p containing nucleoside triphosphate hy 
   2::233  1.4e-28 35.0% 0043794 00437941 1/1   p containing nucleoside triphosphate hy 
   1::130  1.8e-28 39.8% 0038720 00387201 1/1   p containing nucleoside triphosphate hy 
  26::234  2.7e-28 34.2% 0049343 00493431 1/1   p containing nucleoside triphosphate hy 
  27::240  4.3e-28 32.8% 0049657 00496571 1/1   p containing nucleoside triphosphate hy 
   4::226  5.8e-28 34.5% 0050374 00503741 1/1   p containing nucleoside triphosphate hy 
  25::239  8.2e-28 36.1% 0046441 00464411 1/1   p containing nucleoside triphosphate hy 
  29::205  1.3e-27 41.9% 0048702 00487021 1/1   p containing nucleoside triphosphate hy 
   2::200  1.7e-27 35.7% 0037996 00379961 1/1   p containing nucleoside triphosphate hy 
  30::223  1.2e-26 33.7% 0036857 00368571 1/1   p containing nucleoside triphosphate hy 
  13::220  3.5e-26 32.9% 0046895 00468951 1/1   p containing nucleoside triphosphate hy 
  19::236  6.3e-26 26.8% 0049073 00490731 1/1   p containing nucleoside triphosphate hy 
   3::223  9.1e-26 28.2% 0049853 00498531 1/1   p containing nucleoside triphosphate hy 
   1::214  2.7e-25 33.5% 0043440 00434401 1/1   p containing nucleoside triphosphate hy 
   5::242  3.3e-25 30.9% 0048957 00489571 1/1   p containing nucleoside triphosphate hy 
  28::198  8.6e-25 36.9% 0048410 00484101 1/1   p containing nucleoside triphosphate hy 
   2::214  2.3e-24 29.6% 0037926 00379261 1/1   p containing nucleoside triphosphate hy 
   5::198  1.5e-22 34.0% 0047701 00477011 1/1   p containing nucleoside triphosphate hy 
  14::215  4.1e-22 34.4% 0040419 00404191 1/1   p containing nucleoside triphosphate hy 
   3::217  3.1e-21 25.9% 0043986 00439861 1/1   p containing nucleoside triphosphate hy 
  26::205  1.1e-20 34.0% 0053247 00532471 1/1   p containing nucleoside triphosphate hy 
  27::213    5e-20 41.4% 0049919 00499191 1/1   p containing nucleoside triphosphate hy 
  28::222  8.4e-20 30.8% 0048044 00480441 1/1   p containing nucleoside triphosphate hy 
  11::229  2.7e-19 30.9% 0044438 00444381 1/1   p containing nucleoside triphosphate hy 
  22::198  3.1e-19 37.2% 0045157 00451571 1/1   p containing nucleoside triphosphate hy 
  21::214  3.4e-19 33.1% 0051138 00511381 1/1   p containing nucleoside triphosphate hy 
  28::228  4.6e-19 31.0% 0051376 00513761 1/1   p containing nucleoside triphosphate hy 
  26::219  4.3e-18 32.7% 0048963 00489631 1/1   p containing nucleoside triphosphate hy 
  28::222  2.3e-17 30.6% 0049881 00498811 1/1   p containing nucleoside triphosphate hy 
  11::218  1.5e-16 36.8% 0039270 00392701 1/1   p containing nucleoside triphosphate hy 
  11::216  2.5e-16 28.4% 0040678 00406781 1/1   p containing nucleoside triphosphate hy 
  26::208  3.2e-16 27.5% 0047073 00470731 1/1   p containing nucleoside triphosphate hy 
  27::224  7.3e-16 29.3% 0040588 00405881 1/1   p containing nucleoside triphosphate hy 
  19::243  7.4e-16 24.4% 0048025 00480251 1/1   p containing nucleoside triphosphate hy 
   6::200  9.4e-16 26.5% 0048255 00482551 1/1   p containing nucleoside triphosphate hy 
   8::205  5.9e-15 28.1% 0052726 00527261 1/1   p containing nucleoside triphosphate hy 
   2::199  2.7e-14 33.3% 0042094 00420941 1/1   p containing nucleoside triphosphate hy 
  16::202  7.8e-14 29.6% 0039472 00394721 1/1   p containing nucleoside triphosphate hy 
  21::196  8.3e-14 39.8% 0043218 00432181 1/1   p containing nucleoside triphosphate hy 
   2::201  9.3e-14 30.3% 0043792 00437921 1/1   p containing nucleoside triphosphate hy 
  26::193  2.2e-13 35.8% 0051535 00515351 1/1   p containing nucleoside triphosphate hy 
  14::229  2.4e-13 27.4% 0051325 00513251 1/1   p containing nucleoside triphosphate hy 
  23::247  6.2e-13 24.4% 0049933 00499331 1/1   p containing nucleoside triphosphate hy 
   9::211  3.5e-12 21.7% 0041617 00416171 1/1   p containing nucleoside triphosphate hy 
   7::199  9.8e-12 28.2% 0040237 00402371 1/1   p containing nucleoside triphosphate hy 
  26::191  1.7e-11 26.7% 0046162 00461621 1/1   p containing nucleoside triphosphate hy 
  26::199  9.3e-11 31.1% 0051958 00519581 1/1   p containing nucleoside triphosphate hy 
   5::199  1.6e-10 33.0% 0038674 00386741 1/1   p containing nucleoside triphosphate hy 
  27::214  3.6e-10 28.0% 0047607 00476071 1/1   p containing nucleoside triphosphate hy 
  25::202  5.3e-10 32.1% 0043790 00437901 1/1   p containing nucleoside triphosphate hy 
  20::196  5.9e-10 28.5% 0051769 00517691 1/1   p containing nucleoside triphosphate hy 
  26::191  7.3e-10 21.8% 0037884 00378841 1/1   p containing nucleoside triphosphate hy 
   5::199  1.1e-09 28.9% 0036729 00367291 1/1   p containing nucleoside triphosphate hy 
   1::199  1.4e-09 29.9% 0052155 00521551 1/1   p containing nucleoside triphosphate hy 
  21::218    3e-09 26.7% 0053315 00533151 1/1   p containing nucleoside triphosphate hy 
  11::199    7e-09 27.2% 0043012 00430121 1/1   p containing nucleoside triphosphate hy 
  27::216  7.6e-09 26.6% 0047808 00478081 1/1   p containing nucleoside triphosphate hy 
  27::218    1e-08 26.2% 0045785 00457851 1/1   p containing nucleoside triphosphate hy 
  23::200  3.4e-08 27.0% 0047291 00472911 1/1   p containing nucleoside triphosphate hy 
  27::177    9e-08 28.2% 0048272 00482721 1/1   p containing nucleoside triphosphate hy 
  28::221  1.3e-07 28.7% 0051604 00516041 1/1   p containing nucleoside triphosphate hy 
  28::222  2.2e-07 26.3% 0049606 00496061 1/1   p containing nucleoside triphosphate hy 
  22::215  4.3e-07 24.1% 0047839 00478391 1/1   p containing nucleoside triphosphate hy 
  28::168  9.2e-07 28.8% 0046916 00469161 1/1   p containing nucleoside triphosphate hy 
   8::199  1.2e-06 29.9% 0047394 00473941 1/1   p containing nucleoside triphosphate hy 
   4::201    4e-06 26.8% 0048266 00482661 1/1   p containing nucleoside triphosphate hy 
  15::230  5.9e-06 22.9% 0041053 00410531 1/1   p containing nucleoside triphosphate hy 
  16::62   1.1e-05 40.4% 0049577 00495771 1/1   p containing nucleoside triphosphate hy 
  26::188  1.1e-05 31.9% 0048706 00487061 1/1   p containing nucleoside triphosphate hy 
  11::199  1.5e-05 27.7% 0041830 00418301 1/1   p containing nucleoside triphosphate hy 
  11::47   2.4e-05 37.8% 0041032 00410321 1/1   p containing nucleoside triphosphate hy 
  20::183  4.9e-05 27.5% 0040984 00409841 1/1   p containing nucleoside triphosphate hy 
  23::205  7.1e-05 25.0% 0048939 00489391 1/1   p containing nucleoside triphosphate hy 
  25::217  0.00016 25.6% 0045788 00457881 1/1   p containing nucleoside triphosphate hy 
  27::214  0.00018 26.5% 0049317 00493171 1/1   p containing nucleoside triphosphate hy 
  27::177  0.00023 25.0% 0050989 00509891 1/1   p containing nucleoside triphosphate hy 
   1::60   0.00037 31.7% 0047127 00471271 1/1   p containing nucleoside triphosphate hy 
  23::199  0.00055 31.6% 0040121 00401211 1/1   p containing nucleoside triphosphate hy 
   1::248


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MLRLENVNKTFGGNLALKDITTTFENNQTTVLVGPSGSGKSTMLRSLNLLEMPESGKYYFDDLELDFKKG
00390411   1/1  ---MknlslrygnfralkdvslelppG.ltalvGpNGsGKStLlkalagllgpdsglrvgklsdlirrga
00509431   1/1  Mlelknlslsnfr..vlkdelvslefepg.ltaivGpNGsGKStlldalagllggrslrllragglsdli
00367901   1/1  -lelknlslsyg.ksilkdvsleip.geltalvGpnGsGKStllkalagllgpdvsallrlsglidlilk
00379581   1/1  lepllevenlsksyggvlalkdvsltvkpgeivalvGpnGsGKSTllkllagllkptsGeilldgldita
00422801   1/1  -llllllallllllllllldpllelenlsksyggrlvlalkdvsltvkpgeivalvGpnGsGKSTllkll
00378981   1/1  lpllelenlsksyggvlalkdvsltvepgeivalvGpnGaGKSTllkllagllkptsGeilldgldllll
00361211   1/1  plellgepllelenlsksyggitalddvslgirkGeivllvGpsGsGKStllrnllagllaptggsvlld
00440861   1/1  MpllslgepllelenlsksyggvvalkdislsipkGeildlldellellkeldgsllnvalvGpsGsGKS
00475891   1/1  lllelllevknlsksyggvlalkdvsltikpgeivalvGpnGsGKSTllkllagllkptsGeilldgkdi
00500441   1/1  lllelllelknlsksyggvlalddvsltikpgeivalvGpnGaGKSTllkllagllkptsGeilldgkdi
00420701   1/1  lpllelenlsksypgggvlalkdvsltvepgeivalvGpnGsGKSTllkllagllkptsGeilldgldll
00425571   1/1  -lelenlsksyggvlalkdvsltvepgeivalvGpnGaGKSTllkllagllkptsGeilldgldllalsl
00482201   1/1  llllelknlsksyggvlalkdvsltikpgeivalvGpnGsGKSTllkllagllkptsGeilldgkdilgl
00490801   1/1  -llllllllalllelleeeeellllllalllllgdpllelenlsksyggvpalkdvsltikpGeivalvG
00466931   1/1  -----Mkllslslgnfralkdvslelp.geltalvGpNGsGKStLlkalagllgpdsGeilldgkdilal
00510251   1/1  -lllllllllaeellelleeeelllllllllllllgdpllelenlsksyggvpalkdvsltikpGeival
00502741   1/1  -lllevenlsksyggvlalkdvsltikpgeivalvGpnGsGKSTllkllagllkptsGeilldgkdilgl
00404101   1/1  --elenlsksyggvlalkdvsltvepgeivalvGpnGaGKSTllkllagll.ptsGeilldgldltalsl
00482261   1/1  -lllevenlsksyggvlalkdvsltikpgeivalvGpnGsGKSTllkllagllkptsGeilldgkdildl
00466971   1/1  llalllevknlsksyggvlalkdvsltikpgeivalvGpnGsGKSTllkllagllkptsGeilldgkdil
00475991   1/1  lllaaelpelgelllevvnlsksyggvlalkdvsltikpgeivalvGpnGsGKSTllkllagllkptsGe
00530591   1/1  llllllaleelpllgelllevknlsksyggvlalkdvsltikpgeivalvGpnGsGKSTllkllagllkp
00458601   1/1  -lllevenlsksyggvlalkdvsltikpgeivalvGpnGsGKSTllkllagllkptsGeilldgkditgl
00495371   1/1  esalellleledltklstgikaLddv.lggglpkGeivlllGpsGsGKttlalrllagllkp...evlvd
00436071   1/1  pllelenlsksygg.lalkdvsltvepgeivalvGpnGaGKsTllkllagllkptsgeilldgldlla..
00485451   1/1  --------skiygd.ealkdvsleikkllnlsgkpgeiigivGpsGsGKsTllrlLagllkpllltggkv
00424961   1/1  lgepldglgplrpapgllelenvsksygtgialidlslpigkGervalvGpsGaGKttLlrliaglldpd
00500611   1/1  pgllsllelllelenltklptgipaLddv.lgggipkGeivllvGpsGsGKTtlllqlagllapdsgeil
00372301   1/1  yvlPllsdgmpllelenlrkpyggllvlndvsl...pgeivaltGpnGaGKSTllrllaglllpasggil
00469451   1/1  allelenlskiyggvpkalddvslgiepGeivalvGpsGsGKstllrllagllaglptsGeillldgkdv
00498251   1/1  vekllglalllieklflkvlprllsllelenlskiytgipal.dvslglgGlppGeivlllGpsGsGKTt
00488521   1/1  lllllalelllevenlristgikeldkllsgglppgeitlivGpsGsGKTtLllqlavngllppdsGei.
00496111   1/1  ---elenltklytgikaLddllslgippGeivllvGpsGsGKTtlalrllagllkptggkvliigle...
00367481   1/1  yvrPelldepllelengrhPllsksyggkvvlndislsip.gellvitGPngsGKSTllralaglllpas
00436511   1/1  ievpvglallgrvldllgepidgkgplelgepllevenlsksyggrklvlepletgialddvsltikkGe
00468691   1/1  lsvpvglallgrvldvlgepidglgplllllllpivrlappllelenlsksygtgialidvsltigrGer
00422141   1/1  dlsleelekllelllrdllglgplvklldplleeavvngasdihiepgggllrvryridgvlieliflde
00379601   1/1  llelenlsfsyggkealkdlslaiepgelvlivGptGsGKTTllkallgllppdegiitiegpdel....
00495031   1/1  lsalellleledltkistgipaLddvlsggipkGelvllvGpsGsGKTtlllqlagllalglgliplggk
00457311   1/1  ------------------------mkkgeiigivGpsGsGKSTlarllagllekpgsgvividgd..dly
00503371   1/1  ---------Mmlkslelknfkslkdvsligdfspg.ltaivGpNGsGKStlldaiagllgpdsgeirldg
00532531   1/1  -------------vlalkdvslviekGevvallGlSGsGKTTLlrllagllipddgeilidggdinlegg
00448931   1/1  ----------------LddvslsvepgevialvGpnGsGKTTllnalagllapdggkvllvgadiarla.
00437981   1/1  lveklrpknldkvigqeealkdlslalkpgeiphalllvGppGsGKttlaralagllgpdsgkilldgkd
00485931   1/1  ---------------------LsvpkgevvalvGpnGaGKTTllallagllaptggkvllvgadi.....
00381441   1/1  --------------------------GeliaivGpsGsGKsTLlklLagllppdsgsigslttrlprlge
00475521   1/1  -------------evlalhgvsldve.gevvllvGpsGsGKStllralag.....sGeilvdg.dlv...
00478411   1/1  -----------Ggvlalhgvsldve.gevvlltGpsGsGKStllralagl.....Gtilldg.dlvrlgl
00468601   1/1  ------------------dlslevkkgevialvGpnGvGKTTllakLagllapqggkvlllgaDiyraaa
00371631   1/1  mseliiylelselewallradvgltlteaelkrlkglndlleledlskiygplsrlikllleellrllgk
00414121   1/1  ------------------------kpgevvllvGpsGaGKTTLlrallglleglkvaviepdfgeilidg
00464791   1/1  lsvpvgdkllGrvldvlgepidglgpllalerlpierlappllelenlskrfgtgivlidvslpigkGer
00515511   1/1  -------------------------kgekvlllGlsgsGKSTllnrllgleflpgpTigptegtieidgv
00356411   1/1  ---lknlsksygilkalkdislelkkgikilllGlsgsGKSTllnrllgleygpTiginegtieidgvkl
00515531   1/1  -------------------------kgekvallGlsgsGKSTllnrllglefaygpTigptsgtieidg.
00462761   1/1  ----------yygdvtaldgvsltikkgevialvGpsGsGKsTlaraLagllpeepgsgvvlldgddlr.
00477971   1/1  ------------------------hkgelvvlvGPsGaGKsTLlnaLlgll.ptsgvisvsgttrpprpg
00475371   1/1  ---------------alddvslsikkgevialvGkgGvGKTTlaanlagllaptggkvlligaDi.....
00426051   1/1  ------------------------kpgevialvGpsGsGKSTlakllakelglefidsgdilrdgvdlg.
00368501   1/1  -kerllllelrnvllddviGqeeakealsealelplkrpelfdglgvelpgknvlLvGppGvGKTtlara
00478441   1/1  -----------aevlalhgvsldin.gegvlivGpsGsGKStlalaLagl.....Gailvdd.dlvll..
00480471   1/1  --------------------sleikkgekvaivGpsGsGKSTLlnaLagllsptsvpettrdfilgeill
00475381   1/1  --------------------------mkgeiialtGpsGsGKsTlarlLagllkptsgivsvdglrlavl
00533501   1/1  --------------------------rgeiialtGpsGsGKsTlaklLaellphldtgdvlldgepigtp
00510561   1/1  ldglgepldgllpilaklfrpievlalgllerksverlstGikaLDlllgiGglprGelvliaGppGsGK
00508671   1/1  -----------------hvsllklgeldislsikkgevivlvGpsGsGKsTlaraLakrLeepgsgvvll
00512891   1/1  ---------------------------evilltGppGvGKTTlakalagelgakfgsvsltgrdv.....
00437941   1/1  -lrplveklrpknlddvygqeevlkalslalekgrpehlllvGppGtGKTtlakalaglllptsggvrvl
00387201   1/1  mssgepllevenlskryggklalkdvslsvekgeivlLlGpnGaGKTtLlralagllgptsfvvsptftl
00493431   1/1  -------------------------kGelivllGpsGaGKsTllkllagllgptsgvisvggttreprpg
00496571   1/1  --------------------------GkgelivllGpsGsGKsTlarlLagll...ggsvldtgepir..
00503741   1/1  ---fifldlrplallplpdrlvgrdeeiealskalgg..aldgvslsiepggivllvGppGvGKTtLakl
00464411   1/1  ------------------------vkkgeiivllGpsGsGKsTlaklLagllgptggsvlltgepvsgep
00487021   1/1  ----------------------------rmkiivltGpsGsGKsTlarlLaell....gvvvidtddllr
00379961   1/1  -yrpvdfddivGqeealralslalaagppegvllvGppGtGKstlaralagllppdsg...rivlvgnls
00368571   1/1  -----------------------------llgvrllpplppklagllplagladgdglgvllGklldgvp
00468951   1/1  ------------lnvlgesidalgkilseilkllekgfltalgllerksverlstgikaLDlllgiGglp
00490731   1/1  ------------------dvslsvkkgkvialvGkgGvGKTTlaaklagllakrggkvllidaDp.....
00498531   1/1  --ldklgkildlalkileksflklevlalgvlerkeverlstGikaLDallgiGglprGsltliaGppGs
00434401   1/1  M.....lsksyggllalddvslsvkkgliigitGpsGsGKTTlaraLaellrerggsvavidlddfyr..
00489571   1/1  ----rvknlsksyggktalddvslsvepG.ivgLlGpNGaGKSTllrllaGllkpt..............
00484101   1/1  ---------------------------kgpvigivGpsGsGKTTllraLagllkprggrvavigldi...
00379261   1/1  -drllleelrpvllddviGqeeakealsealrlplkrlelferlglrrpgknvlLvGppGvGKTtlaral
00477011   1/1  ----eelrklldlidklrdlllsldlglpkvaivGrsgsGKSTLlnallGldvlpvgggpgtrrptelrl
00404191   1/1  -------------vellpkvtlddlvgleelkealkealellslgikpgeivllyGppGtGKTtlakala
00439861   1/1  --kleeveristgipeldellgGglpkgslilitGppGsGKTtlalqlaanlaknggkvlyisle.....
00532471   1/1  -------------------------pGkiIvitGpsGsGKsTlarlLaellnglggivsvddlgrdvgel
00499191   1/1  --------------------------kgkiigitGpsGsGKsTlaklLaellgatvgdvd..........
00480441   1/1  ---------------------------rlivllGpsGaGKsTlaklLaell.pglivisvgdttrepreg
00444381   1/1  ----------asdelekllelrpvlledvigqeeakkalslalelplkrlelfgklddligrspairrll
00451571   1/1  ---------------------MsikkgeiiaivGppGsGKsTlaklLakll....glivldgddl.....
00511381   1/1  --------------------llllkpgglvlitGPtgsGKsttLlralnrleeagkgvilvkdaidtr..
00513761   1/1  ---------------------------kiiaivGkgGsGKTTllnklaglladggkvlvidlDparanlp
00489631   1/1  -------------------------MkgklillvGppGsGKtTlaraLaellglpf........iridgd
00498811   1/1  ---------------------------kPgkiigltGpsGsGKsTlarlLael.....gvividgddlt.
00392701   1/1  ----------agarlaledlslgirpgknvlLvGppGvGKTtlaralagllgapfgrvdasd........
00406781   1/1  ----------aglrlllkdlslgippgknvllvGppGtGKTtlakalagelgvpfvrisase........
00470731   1/1  -------------------------arpltfddvvgqdeakeeleellagllgikkpkvillvGppGsGK
00405881   1/1  --------------------------gervglvGrpgaGKSTLlnaltglkaivsgyp............
00480251   1/1  ------------------EdlslavgkgkvialvGkgGvGKTTtaakLaaalaergkkvllidlDp...y
00482551   1/1  -----everlstgipalDellgGglppgslvliaGppGsGKTtlalqlaanaalplelgklggkvlyist
00527261   1/1  -------npfilgpkvdledfigreeelkeleeal..pkivlltGprGsGKTtllkalakel..gkpviy
00420941   1/1  -lrpvllddvigqeeakeallealalplkrldlglslgirpgkgvllyGppGtGKTtlakalagel...g
00394721   1/1  ---------------aleallealrrgpprnvlLvGppGvGKTtlakalakelaagsgpilldgvpv...
00432181   1/1  --------------------slelkkglkvalvGrpgvGKStLlnallglkvaivsdypgttrdptlgvv
00437921   1/1  -lglllveklrpkllddvvgqeealerlllalkagklphlllvGppGvGKTtlaralarlllgsgggvdv
00515351   1/1  -------------------------mngklivltGppGsGKtTlaraLaerlglpvistddllreav...
00513251   1/1  -------------iellsdlslsipspevvllvGppGsGKstlakklaellgfilidaddlr........
00499331   1/1  ----------------------PslslkkgklivltGppGsGKtTlakaLaerlglpf.idtddllrepv
00416171   1/1  --------diigqeeakkallealslaartgenvllvGppGtGKttlaralakllprsgvpfvrvncsal
00402371   1/1  ------vlektgipltkllrpvllddviGqeealeallealrrrpgrnvllvGppGvGKTtlaralagll
00461621   1/1  -------------------------mkgmiialtGppGsGKsTlaklLaerlglpfistddly.......
00519581   1/1  -------------------------kpkvilltGppGvGKttlarlLakllglpliidldalaellfgdv
00386741   1/1  ----klrpvllddvvgqeeakeallealkavllgirpgehllLvGppGtGKTtlaralagel....ga..
00476071   1/1  --------------------------kgkiigltGpsGsGKsTlaklLaelglpvidtddltregvll..
00437901   1/1  ------------------------slllvekyrpvllddvvgqeeakeallealalararplkrpelfls
00517691   1/1  -------------------lsfelkpglnvgivGhvgaGKSTLlnallgllgaivgdvlvdg........
00378841   1/1  -------------------------kelkillvGdsgvGKstLlnrllgdefiveyiptigvdvytktve
00367291   1/1  ----vtlddvvgqeeakeallealelalkgldlflslglrpgrnvllyGppGtGKTtlaralanel...g
00521551   1/1  plveklrpvllddvigqeeakeallealarlkapelflslglrpgkgvlLvGppGtGKTtlaralagll.
00533151   1/1  --------------------MsldikkgklivltGppGsGKtTlarlLaerlglpf.istddllrelvpg
00430121   1/1  ----------vgqeeakeallealrrgrkglelgirpggnvllvGPpGvGKTtlakalagllfp......
00478081   1/1  --------------------------gkvivltGppGsGKtTlarlLaellkplgggvvvidtddlrrea
00457851   1/1  --------------------------PkgklivltGppGsGKtTlakaLaerlglpv.istddllre...
00472911   1/1  ----------------------mkmkkgklilltGppGsGKtTlaraLaellgapfisgddllrglageg
00482721   1/1  --------------------------kgkiigltGpsGsGKsTlarlLael...........glpvidtd
00516041   1/1  ---------------------------mlkgklillvGppGsGKtTlaralaeelglpfvvidaddl...
00496061   1/1  ---------------------------gklivltGppGsGKtTlaklLaerlglpv.istddllre....
00478391   1/1  ---------------------msikkgklilltGppGsGKtTlaralaerl.....glpvidgddll...
00469161   1/1  ---------------------------llIvieGppGsGKsTlaklLaerlgltglsvlltre.....dg
00473941   1/1  -------ddvvgqeevkkalllalalallrgepgehvlLvGppGtGKTtlaralagllga..........
00482661   1/1  ---kkvaivllsnyalsislddlllildlykevqvaydnfykvdesdiayqyallakedenaaaflksnr
00410531   1/1  --------------gelknlslelkkglkillvGlngvGKTtllkrlaggefvdygptigvnfktvevdg
00495771   1/1  ---------------alldilldilkgktvalvGpsGvGKStLlNaLlgellattgeipgdg--------
00487061   1/1  -------------------------ldMkkgklIvieGppGsGKtTlakaLaergargldvvviyepvdy
00418301   1/1  ----------iGqeeakkallealalplkrlelfeklrgirpgknvlLvGppGtGKTtlaralakll...
00410321   1/1  ----------yggllllkdlslelkkglkilllGlngaGKTTllnrl-----------------------
00409841   1/1  -------------------lslelkkglkvalvGrpgvGKSTLlnaLlgadlaivsdipgttrdpilgv.
00489391   1/1  ----------------------lsikkgklivltGppGsGKtTlakaLaerl.....glpvistddllre
00457881   1/1  ------------------------m.gklivltGppGsGKtTlaklLaerlg.lpvidtddllrele...
00493171   1/1  --------------------------mgklivllGpsGaGKsTlaklLaeklglivlsvgdttr......
00509891   1/1  --------------------------pkvigitGpsGsGKTTlanaLarllkarglkvavidrdpgrld.
00471271   1/1  prailelesliksllekllellkrlslklkkglkvalvGrpgvGKStLlnallggdfaev----------
00401211   1/1  ----------------------elkrglnvgivGhvgaGKSTLlnaLlgll...................


                         -         -         *         -         -         -         -:140
query           ISKKEILEVRRETEMVFQNYNLFPHLTVLKNIIEGPVHVLKEDKESATKRAYELLKKVGLADKADAYPQQ
00390411   1/1  dkasvelvfeldggllallrllslsggeklrvalakallgnpeillngepvnhldlrelllnllrrrgig
00509431   1/1  flgslirsgadrasvelvfdlsdglyllerselilrrlilkpgsgeilingkdi......slldlrelrr
00367901   1/1  gllllprstvatvelifdllgllliirrlilrdgsgeilidgkdi......slldlrelrrligyvpqdp
00379581   1/1  lslael.....rrrgigyvfqdpalfpgltvrenlalglllllllllllllllllalskaearervlell
00422801   1/1  agllkptsGeilldgldilalslae......lrrrigyvfqdpalfp.ltvrenlalglllallllglsk
00378981   1/1  slae..lllllrrgigyvfqdpalfpgltvrenlalgllla.glskaeaaaraaellellglddlldrlv
00361211   1/1  glei......salslaerlragigyvfqdlalfpeltvlenlalg..............rarellerlgl
00440861   1/1  tLlnaLlgllkpdegvilvggkgvTrdivlytledgvkltliDtpGlgdtklsdeeklilkyleeadlvl
00475891   1/1  lgls.....llellrrgigyvfqdpalfpgltvlenlllgll.llglalkeaalralllllllgletlld
00500441   1/1  ldlsl........lrrgigyvfqdpalfpgltvlenlllgll.llglslaeaaeralelllllgledlld
00420701   1/1  l...lslaellalrrgigyvfqdpalfpgltvrenlalgllla.glskaeararalellellglddlldr
00425571   1/1  ........lrrrigyvfqdpalfpgltvrenlalgllll.glskaeaaaralellellglddlldrlvge
00482201   1/1  s.......lkelrgigyvvqqdallpsltvlenlllgllllgllllllaakeaalralllllllgletll
00490801   1/1  pnGsGKSTLlkllagllkptsGeilidgkdi......tglspqelrrlgglvlqdvllffltll......
00466931   1/1  sp..eellrllrrrigyvfqepalfpgltveenlllglllrlllelllgrlelllllllllellallldl
00510251   1/1  vGpnGsGKSTLlkllagllkptsGeilidgkdi......tglspqelrrlgglvlqdvllffltll....
00502741   1/1  s.......laelrgigyvfqqlallpsltvlenlalgll.llglskaeaaaraaellellgledlldrlp
00404101   1/1  ael......rrgigyvfqdpalfpgltvrenlalgll......kaeararalellellgldelldrlvge
00482261   1/1  s.......laelrgigyvfqqdallpsltvlenlllgllllgellllllaakeaalralllllllgletl
00466971   1/1  glslael..llllrrgigyvfqdpalfpgltvlenlllgllllglllllaakeaalrlellllllgletl
00475991   1/1  illdgkdildls.......laelrgigyvfqqdallpsltvlenlllglllagellllllaakeaalral
00530591   1/1  tsGeilldgkditdls.......lkelrgigyvvqqdallpsltvlenlllgllllgllllllaakeaal
00458601   1/1  .......spqelrrlggvvvqevllffltllenlllglallllllvlllllllllllllaakeaalrall
00495371   1/1  gldltglspa........rggiglvfqteallppltvrenlealgldlrglld....rerviellelvgl
00436071   1/1  .........lrrgigyvfqdpalfpgltvlenlalgllllgll...ealaralellellglgdl.drlvs
00485451   1/1  lvigldifrlsa...relrkrig....vfqdpallphltvpenldlglll.......eilervlellelv
00424961   1/1  sgeilldgvdigersrevtelleelrrviglvfqdpplfprltvaenialgaeyf.rdegadvllladsl
00500611   1/1  lggkvlyislee.....slrrrrigmvfqelgldpdltv..................arerviellelvg
00372301   1/1  vdgedlr................igyvfq...................................llervg
00469451   1/1  ly...lsleesleqlrrrigyvfqdpalfp..........................aeellelvgledll
00498251   1/1  Lalrllagllkpgggvvyidgeesldll.........rarrlgvvlqelllfpeltveenl.........
00488521   1/1  ....................ggkvlyvdqeeslfp.ltvlenlalg............gedveellerlg
00496111   1/1  ...lsaeelrerrrrigyvfqepalfpeltvlenlalgll...........................drl
00367481   1/1  ggilvpgedalll...................................................rvdeil
00436511   1/1  rvglvGpsGaGKtTLlkllagllkpdsGeilvdgligerlrevlelirelelaelrrrigyvfqdpalpa
00468691   1/1  vglvGpnGaGKttLlkllagllkpdsgeilvd........Gedlrelrelrrrigyvfqdpalfpeltvl
00422141   1/1  eellallsrlkslaglpilearlpqggriqavlppvvvdfrvstlpdigglslvirklreviltledlgl
00379601   1/1  ........lrnkigyvfQdpvlfp.ltvren.......................................
00495031   1/1  vlyiglelt....lsperlrlraqsl...........................gldldellerllvidll
00457311   1/1  k.lsreelrklrrrigmvfqdpalflnpgltvrenlaeplrll.klgkk........llepvglpevldr
00503371   1/1  kdlliylsdlir.....rgagiayveqefdlfdgltvlenvllglgdeliirrrilrdgrseyllnglgv
00532531   1/1  fyakaigllrrkigyvfq...lfpfltvlenvalgld...glvdeedleraenllalvgleeipnrypse
00448931   1/1  ........areqlgivfqd....pgltvlenlalg..........eleararellellgledydvvliDt
00437981   1/1  i..............rrgiglvfqliglfphltvlelvalglggilveevrellkel.............
00485931   1/1  ..........rrigavpqlpvlfprltvlenlalg........gadlaeraeellellglegfdvvliDt
00381441   1/1  vdgvdltfls..........reeigyvfqepallpdltvlenlylglllalllaleegkivildgdrera
00475521   1/1  .....dleplrrdigmvfqdpalfplltvrenvilgllelaglskaealarvdellelvglddellldrl
00478411   1/1  kd.........gigmvfqdpalfplltvrengvalglllaglskaeieervdlllelvglddlldrypde
00468601   1/1  ae.......rlgigavpqdvplfpsltvldnlalar.dlleaa..kaagydvvlidtaglld.ldrlvge
00371631   1/1  lalddvslsvkkpeiigiaGpsGsGKSTlarlLagllapesgglkvlligtD......ifylpa.eqlkr
00414121   1/1  qll......edlgvlavrlgigyvpqtlglfpaltvlellalalllredpdlilid..............
00464791   1/1  vglvGpnGaGKTtLlkllagllkpdsgeivvyg..ligerprevrellglllelgvlf............
00515511   1/1  klqlwDtgGqerfrslwllyfegadaiifvvdlsdgds...llalrrwigrlfqslnllesllvlenlan
00356411   1/1  tlwDtgGqesfrklwilyfegadaiifvvdasdrdsflnldkwrnrlgevlqllelilnltvlenv.pii
00515531   1/1  .vklqlwDtgGqerfrslwilyfedadaiifvvdlsdrdsflelrrwigrlfqdlnlfpsltvlenlanv
00462761   1/1  ...........lglliglvfqdpdllpfltvlenvllpllaagliv......ivdgtlllvglrealrkl
00477971   1/1  ........evdgvgyvfqsrelfpeltvagnflegae.vrgnlygtsrerveellea.gldvlldidpqg
00475371   1/1  ..........................................rrpsarellgllgellgldvlvgarggd
00426051   1/1  ..gesglllrdlrrliglvfqdpilfpgltvglllffldnidlgllirgdeeleaalelaglprvielll
00368501   1/1  lakll.......gapfiridgseltekdyvGesvearlrelfeeaigyvfqdpalfpg.tvlenlalgll
00478441   1/1  ......elrgrdilmvfqppalfpllevrglniaevlela.glskaealkrvdlvlelvgld...drypy
00480471   1/1  dgkdltlvdtpgiargrlklllearraaigivfqdvdllltltvaenlllg.ldllllellkelkydpvi
00475381   1/1  srdllgllreglirigyvfqdyalfprltvlenvllgll.........................llgglv
00533501   1/1  ..........lgrgigyvfqdpalfpgltvrenlelllvfadrygvlrglikpalaegvsvildrvglsd
00510561   1/1  Ttlalqlaanlaaqggkvlyisteesleql........rarrlgldldrlllldaltv............
00508671   1/1  dgddlraglsiglilsdedraalrrrlgevfqelllagrlvvldgtalgl.elrdelrellkeaglpll.
00512891   1/1  ......rsarrgigyvfq........tveellgllaelvgle.............vrgeleellktlike
00437941   1/1  gidaselld.............................................................
00387201   1/1  vreyelGeilldgrdlyrlsleeallllfldeileidglllvelregigyvfqdpalfpe----------
00493431   1/1  ev........rgigyvfqsgalfphlivagnlleg.aevhgllygtskerveeale....kgllvlldrd
00496571   1/1  .....geplgelir.glvfqdpllldeltvlenlalgrylhlglilaalaagvgvvldrvglsdlaygfp
00503741   1/1  lagllkpkfgeillfg..........................................kvvyvnvselld
00464411   1/1  lge..........ligevfqdgilfpdltvlenvalgrygllglikealaegvivildrvglsdla..yp
00487021   1/1  a...............gevfqdyalfphltvlelldnvllgleir.gllkaerlervevllervgl..ll
00379961   1/1  dlldpkdlrellragiplvflnfaalpasllesel...................................
00368571   1/1  vtldlgelgrhllivGptGsGKStllrllaglllpdggrviv....iDpkgeyaglarglgvvildpgdg
00468951   1/1  rGelvlivGppGsGKTtlalqlaanlaklggkvlyid.......teesldqlr..arrlgldlddllllp
00490731   1/1  ..........................................yrpaadellgvlaeelgldvllgarggd
00498531   1/1  GKTtlalqlaanlaklggkvlyisteesleql........rarrlgldldellllpaltveellala...
00434401   1/1  ..paaelllreglgidfqlpdal.......................drellreevlellglgevvivdvy
00489571   1/1  ......................................................................
00484101   1/1  ...grldldellg.igylfqdvgllpvltvrenlalllrglpgysaeele.ralellelagfdvilieGl
00379261   1/1  Akll.......gapfvevdaselteggyvgedlekrirelfqearllvfltvlenirldaseylekrvvs
00477011   1/1  set..pgltvlvvflelgerldllglvfqdfsllpelielenralagpiagisrdairleielpglpdlt
00404191   1/1  nelkkrggrvlyvsa.......................................................
00439861   1/1  .esreqlleraerlgldleellllgll...................................siliadpl
00532471   1/1  ggaalldivdegrliglvfqdldllpllevlellaa........................rleellerip
00499191   1/1  ..........gllvgvvfqddfylllpalevlengafll.dlllpdaldrelllelllalveglvvlldr
00480441   1/1  evlgv........dyvfvdrelfeelivagnlled.aivhgllygtskerieealda.glgvlldgfprg
00444381   1/1  ellgarpgenvlLvGppGtGKTtlakalakll..gvpfirid............................
00451571   1/1  ........lreaiglvtqdgelllelid.egilvpdeiv............iellrealeeldadgvild
00511381   1/1  ....lgielvvsriglvleavglffaldllelll....................................
00513761   1/1  eqlgidirdl.............................idletvme.lglgpngalvfaleellttldi
00489631   1/1  dllrellgellgrgigfgfqqgdlledatvlenlalllldeidka....................ledgg
00498811   1/1  .....relvaggglliglifqdfglfelldrellielllenlalglal.egvildalrrrllelldllgl
00392701   1/1  ..............................................................llgkyvge
00406781   1/1  ..............................................................llgkyvge
00470731   1/1  TTlaralakel..gagfilidgddl...rekavgeleklgrdlfqvaregglvpdilfideidall....
00405881   1/1  .....gttldpnlgvvelddgrqlvlvDtpGlielaslgeglvrqalealeradvillvvdasdplldqp
00480251   1/1  rpsapeqlgilgellg.................vpvvgvltgldlagalrealell....llegydvvli
00482551   1/1  eeafsperlreralsl...............................gldleelldrllvidatdlldll
00527261   1/1  idlselsskgyvdleellrela..........................eelgellellkkllkklsellg
00420941   1/1  apfiridg..............................................................
00394721   1/1  .........................................................vrldlsellsvsd
00432181   1/1  eldgrkl.........................................................vliDtp
00437921   1/1  i..eldasdlrgvddl...religevlqalglllgg..................................
00515351   1/1  ...........pggtdigelfqdyllfpfltvdeni...............rglllealeellaag.kvv
00513251   1/1  ......................................................................
00499331   1/1  ig.............agtdigevfqdlllaggllvddev..................rrlllealdelll
00416171   1/1  te..........................................................dlleselfgh
00402371   1/1  vrssgpilldgvpf........................................................
00461621   1/1  .....revvergtelgklikdyfdpgalvpd.llirlllerllfldegggflldgfprtleqaeals...
00519581   1/1  gglvvdli..............................................................
00386741   1/1  ......................................................................
00476071   1/1  .......ggpllerirellgegyllfdealdrellaallfglelegal......................
00437901   1/1  lgirpgrillLyGppGvGKTtlakalakel...gapvieidaselrd.......................
00517691   1/1  ..............................................gtlllllgllsfllalvldslple
00378841   1/1  idgkkvklqlwDtaGqerfrsllelyyr.......gadgillvvdvtdresfeelkkwleeilrlle.ag
00367291   1/1  apfirvda..............................................................
00521551   1/1  ..gapfvrlsas..........................................................
00533151   1/1  gldig................evfqda.leaglllfddefrglller...................leel
00430121   1/1  ....................................................sgvpfirinlseltekll
00478081   1/1  irell.lgldlleilf......................................................
00457851   1/1  ...........avpggtrlgeviqdlfllggllffdeldel............lkerieellaag.gvil
00472911   1/1  gkpl...............................................................gll
00482721   1/1  dlyrelvaggtplgerirellgegyllpdea.........lfrallaellfgdllalalldgvvydrlrd
00516041   1/1  .......lrgeelgriielfdearelvpelallfideidell...........................a
00496061   1/1  .........evepggtdlgeifqalllagel.lfddevlgll.......rerldelielllagg.vvild
00478391   1/1  ...relvgeggrlgrdlfdedrllfrellideidl...................................
00469161   1/1  fgtplgelirelllegfqdlilvpdllvlellaanraglrelikellaagkgvildrfplsrl....ayq
00473941   1/1  ............................................................pfielsasdl
00482661   1/1  qkklvrdladrviaeerlellekiieellrirldklledldeiveelppvlfddlvgqeeakeallenlk
00410531   1/1  vkl...............................................................viwD
00495771   1/1  ----------------------------------------------------------------------
00487061   1/1  waavgggdllr..................................................lirelllrl
00418301   1/1  .gr..................................................................p
00410321   1/1  ----------------------------------------------------------------------
00409841   1/1  ......................................................................
00489391   1/1  avpggtdlgel.......fqdlllegellfideiaelllealae..........................
00457881   1/1  .......pdgtelgellqdlllaggllpdaivrdlllel...............leelladgkgv.ildg
00493171   1/1  ........epregevdgvdyvfvsgelfkelidagelledaivi.........gllyergtlldavegal
00509891   1/1  ................................ldeplgv.....drerlrrvgelalllaggglcalvad
00471271   1/1  ----------------------------------------------------------------------
00401211   1/1  ...............................................................ldtlkge


                         +         -         -         -         -         *         -:210
query           LSGGQAQRVAIARSLAMNPRYILLDEPTSALDPELELEVLKVLLQLAKEKQSLIIVTHNLAFAQKVADKI
00390411   1/1  lvpqehdlfplltvaenialldelaglpkygnylsllkeklkelnallkelelqlkelarllelleglke
00509431   1/1  ligyvpqdpnllfqltvlenlllgpeerrelldellglellsleealaraeealeelnallkeleeelel
00367901   1/1  alfpqltvlenlllglelrrklldellgllellalleellklleellkelevleaalaallkeeieerae
00379581   1/1  elvgldtlldrlvgeLSgGqrqrvalarallldpdllllDEptsgLDpetraellellrelakegltvll
00422801   1/1  aeararalellellplgldtlldrlvgeLSgGqrqrvalArallldpdllllDEptsgLDpetraellel
00378981   1/1  geLSgGqrqrvalarallldpdllllDEptsgLDpetraellellrelakelgltvllvthdlsealrla
00361211   1/1  ail.drlpgeLSgGqqqrvaiaralaldpdllllDeptsalssrssendpetvaellellkelakelgvt
00440861   1/1  lviddglteldlellkllkelgkpvilvlnkiDllkkeelekllkslnkelglkelrrgigyvfqdpnlf
00475891   1/1  rlvseLSgGqrqrvalarallldpkllllDEPtsgLDpetraellellrelakegltvllvthdldealr
00500441   1/1  rlvseLSgGqrqrvalarallldpdllllDEPtsgLDpetraellellrelakelgltvllvthdlseal
00420701   1/1  lvgeLSgGqrqrvalarallldpdllllDEptsgLDpetraellellrelakelgltvllvthdlsealr
00425571   1/1  LSgGqrqrvalarallldpdllllDEptsgLDpetraellellrelakelgltvllvthdlsealaladr
00482201   1/1  drlpseLSgGqrqrvalArallldpkllllDEPtsgLDpetraellellrelak.gltvllvthdlsea.
00490801   1/1  .....lllaakeaalralllllllgletlldrrpseLSgGqrqRvalArallldpdlllLDEPtsgLDpe
00466931   1/1  llllllllllllllllllvlllllllllvlllllllalllllalkeaallleelllllglgdlldrpvst
00510251   1/1  .......lllaakeaalraellllllgletlldrrpseLSgGqrqRvalArallldpdllllDEPtsgLD
00502741   1/1  seLSgGqrqrvalArallldpdllllDEPtsgLDpetraellellrelakegltvllvthdldealrlad
00404101   1/1  LSgGqrqrvalarallllleelsldpdllllDEPtsglDpetraellellrelakegltvllvthdldea
00482261   1/1  ldrlpseLSgGqrqrvalArallldpdllllDEPtsgLDpetraellellrelak.gltvllvthdlsea
00466971   1/1  ldrlvseLSgGqrqrvalarallldpdllllDEPtsgLDpetraellellrelakegltvllvthdldea
00475991   1/1  llllllgletlldrlpseLSgGqrqrvalArallldpdllllDEPtsgLDpetraellellrelakeglt
00530591   1/1  ralllllllgletlldrlpseLSgGqrqrvalArallldpkllllDEPtsgLDpetraellellrelak.
00458601   1/1  lllllgledlldrlpseLSgGqrqrvalArallldpdllllDEPtsgLDpetraellellrelakegltv
00495371   1/1  eelldrlprelsggnqrqrvvia.alallpkllllDEptsaldvslraeilrlLkrlakelgvtvllvth
00436071   1/1  eLSgGqrqrvalarallldpdllllDEptsglDpetralllellrelaeelgltvllvthdldlalalad
00485451   1/1  gldvvlldtyphelSgGqrqRvaiaralaldpdvlllDEptsglDpetralelldllrtdldkelgrtii
00424961   1/1  lrlagalrevlgrlgrelSgGqkqrvaiarallleragnleggGsiTalatvlveggsdpdllllDepts
00500611   1/1  llelldrlprelkrsggqrqrvviDaralllrpe.l.lDEptsaldvslraeilrlLkrlakelgvtvll
00372301   1/1  ledlldrlpstlsgGqrqrvai.ralatepsllLlDEptsgldpelraalaeallellaelgatvlfvtH
00469451   1/1  drlpgelSgGqrq..aiara.ardpdllllDeptsalrgsenDpetraeilrlLkelakelgvtvilvtH
00498251   1/1  .......................drlprllsggqrqrvvidsalalrpkllllDEPtsgldplsarelle
00488521   1/1  l.dlldrlphqlsggqrqrvaiaralaeelkpdllvlDeitalfraelegrptsaldvsllrellrlLkr
00496111   1/1  pgeldlSgglqrqrvaia...agdpdllllDeptsalrslgndpelraellrllkrlkelgvtvilvthd
00367481   1/1  trvglsdlldrgls.lsggerqrvalaralatdpslllLDEptsgldpedgaalaeallellaellgatv
00436511   1/1  llrllalfpaltvaenlrfglglavlllldsatrlaqakreisalarellervglpgdlftllsrlder-
00468691   1/1  enlalgallag.................lglaeyldelgkdLSgGqrqrvalAr.....pvlLllDEpts
00422141   1/1  sygdpealkdlslaippgglvlltGptGsGKtTllralagllnpdegriltiedp...............
00379601   1/1  ..........laralrqdPdilllDEptsaldae........llqalltghtvvlvthhlntaldladri
00495031   1/1  elvgllelldrlprelsggqrqrvviDalalllrpell..DeptsaldvqlvaeilrlLkrlakelgvtv
00457311   1/1  yphelsgGqrQRv...ralaldpdllilDeptsalgqpdpelr.elldllifldadlgltlirlitrdlg
00503371   1/1  slkeliellldlsggelnrvalllqgevdlllldepterldfldelagleeykgnyeellklleeleell
00532531   1/1  lsgGqqqrv...........illldEPtsgLdpvsr...........................leladri
00448931   1/1  agrlrlpselsggqkqrvaiaralaaplppevllldeptsglda..lrellellrel...gltvlvvthl
00437981   1/1  ......lsgGqkqrvaiaralagdpkvlllDEpt.aldpdaqnaLlklleelak.gvtvilathdlsell
00485931   1/1  agrgrrvgelsggqkqrvaiarallllldpelllldEptsglda..lrlllellkel...gltvlvvthd
00381441   1/1  eellellgldadlviilpasleellerldrrggelsggqkqRvala------------------------
00475521   1/1  p...sggqqqeilrvaiallilpvllgralallpelllldeptsaldpd---------------------
00478411   1/1  lsggqrqrvaiaralalepelllldeptsaldplavvellelllglnee.ldiilalelllldel-----
00468601   1/1  lsggqkqrvaiarala.apevllldeptsgldalae..llelleel...gltvlvvtKlDgtakgghdls
00371631   1/1  igllfq.kglpealdveell....................ellldl.kegledilvpvlsggqkqrlala
00414121   1/1  ..............sgGqkqrlalaralladpdlgellllDeptlvlDaasgedlldllkelaeqlgltv
00464791   1/1  .....................aaellervglvaatadeppgelsggqrqrlaiAraladdqgkpvllllD
00515511   1/1  vpillvl.nKiDlleaklvllllvglfdlldglpselsggqkqrvalara--------------------
00356411   1/1  lvlNKiDlleekive.ellellgleykgdrdpeelsggqkqrvalaralakdpdilll------------
00515531   1/1  pillvlnKiDlleakeraeellellglgdlldklpselsgGqkqrvalarala-----------------
00462761   1/1  lgllsgGqkqrvadlvvlldadpevllaReptrgldpeteeeleellerleereplygadiviithdls.
00477971   1/1  lsggqkqrlalaralilppsllrgldep.ealdarle.raleellelae.gfdvvivnhdleealelldr
00475371   1/1  lsgglrqr..larallgdpdvlliDepgrgldpellallaelldllrelradlgllvvdathdldavlka
00426051   1/1  e.gldtlaggggvvlsGgqrqrvalar.....pdlllfldeptselleRllkrltrpgldadteeellel
00368501   1/1  vseligappgyvggdlggllteavlealriklvegelgfrelerevlldlplhdasviallgggrelrdg
00478441   1/1  elsggerqrvailr..vllpklllpdepgrnldvlievavlnlilkllg.idallelvdrl---------
00480471   1/1  lllnkidllddrllrraeaeerieellelvgl--------------------------------------
00475381   1/1  vildggvrqrlalarallldpdvllldeplllldaa----------------------------------
00533501   1/1  laydgfprllsgggrqrvalaralvvkpdlvilldeplevldeRlrkrgrlelreldseevlekrlehyl
00510561   1/1  ....................eellalaerllsggkvdlvviDsltalapalelsllldeptsgldasllr
00508671   1/1  vvfldaplevlleRdrrglypeelsgglkqrvaiarplelaaepdlvi...dtsald-------------
00512891   1/1  lsggekqrvalarallakpdvlllDEid.gldpdvleallelleelkrsgvtvilttndldel.eladri
00437941   1/1  ......pselsggerqrvliaralladpkvlllDEi.daldpeaqnaLlklleelpk.gvtvilttnrle
00387201   1/1  ----------------------------------------------------------------------
00493431   1/1  lsggqqlrvalaralvvfildpslelldeRlsgrdadtreeirkrlkrlleelgplieydyvivnddlee
00496571   1/1  rtlsglgqrqrvalarallkpdlvifldeppteeldeRlrkrl........rlgdteevlehrleraeel
00503741   1/1  lkellrlllealglp.....ppyqlsggerlrvalaeallalgkpdllilDEitnlldpetlspdvlelL
00464411   1/1  gflsggeqqrvaiarallpkpdlvllldepteeldeRllkRg....rllekleyikkrlehylelaepyk
00487021   1/1  drippalsgGqgqrvildrallselayqpdvllldeplsgldaklreelrdllrellpegilpdl-----
00379961   1/1  ...lsggerqrvalaralalrpGllvlAdggvlllDEp.daldpevqaaLlrlleegevt----------
00368571   1/1  rsvrlnplaliddeedaaellralvsemgrgeddfftpaarallralilalaeepeptldellellselg
00468951   1/1  altveellala................................erllsggkpqlvviDsltalrpallll
00490731   1/1  lsgglrqr..larallgdydvliiDtp.gtldvllelallellkellaelgadvvllvvdatlgleaadr
00498531   1/1  .............................erllsggkpdlvviDsltalapslllldepgrvtqgldarl
00434401   1/1  dlsggerqr...aralasgpdvlilDgptlgldv............lldlpdlvifvdhdlevalerrlk
00489571   1/1  ......lallelrntteagaasgsrdkgllgklkpetraelldllre...egttilvvth.ldeaer.aD
00484101   1/1  lelalplilelrelsdgqiqrvaparallrdpllllldedtvvldkvdlasildllle------------
00379261   1/1  rligappgyvgyglggllteavrrlpysvllldelekahrpirvlllsaslvlllgglglpevgelllel
00477011   1/1  lvDtPGlgsva..vvdqlsggqkqrvalarallknpdtlillvedandldtesdalel------------
00404191   1/1  ................delvsklsgglqeqrvaiafalarkpdllllDEidalgldpelqeellelldel
00439861   1/1  glsgeellrvllalalelkpdlliiDeltalldaervrelrellralkrlakelgvtvilvsqltelild
00532471   1/1  palsggqgqrvildrslysrpavlllllyvdeplsgldvelreelrdlleslllvlplpdlviyl-----
00499191   1/1  yprllsggqrqrvaia.....dpdvlildgptllldpe............................lrpl
00480441   1/1  lsqaqalrlaldlvllldpslevlleRllgrgddteevirkrlerlapeleyyeelgladvvivnddlee
00444381   1/1  ...............................gselte....kelvGesegailsggfkqrvgia..llad
00451571   1/1  gfprllgqaelllsggkadlvifldaplevlleRllkrddekilkrleeqkqrvaiar------------
00511381   1/1  .................qdpdviliDE.aqfldp....evvevlleladtgilvlvtglemdfagelfeg
00513761   1/1  llealelleedydyiliDtpGglelrallalllaiaralaadeillvddptsgldaetqleilelllell
00489631   1/1  vvlldgfdrsqlqrlailrallddppdlvvfldapleellerllkRdgrteeeilerlarleeryradlv
00498811   1/1  dvvilegplllsgglrqrpdlvifldappevlleRllkRggldeetiekrlelylelaplygaadividn
00392701   1/1  lsgglrqr..larallakpsvlllDEidklapkrsptsgldvelrrrvlnaLlrlleglrllsgvtviat
00406781   1/1  lsgglrqrlalara..adpgvlllDEidalldarsgsgsggdsssrrvlnaLlrlleelrllsgvtviat
00470731   1/1  .rkgpdvildgagrtpeqleal..ldlleelgrpvvviilttnrevlldral.rRpgrllldep..el--
00405881   1/1  vellsggekqrlalarallgkpvilvlNKiDep....tneldlellellee...lggtvvlvSahdgegl
00480251   1/1  Dtagglqrglllalaladlllvllldepllvldatagtellelakgllealgldgvvltkldlvaalgaa
00482551   1/1  ellerlrrllsegkvdlvviDslallarael..ldepllgldarelrellrlLkrlakel----------
00527261   1/1  lsilglelilglsggdleelleelaellkklgkpvililDEiqsll.dvsskelleaLlrlldeg-----
00420941   1/1  .....sellgkyvgelsgglrqllalara..akpsilllDEidklapkrsptsaldadv-----------
00394721   1/1  lvgelegglrgllteala..lakpsvlflDEidrlldardsesslevlnaLlrlledgnvlv--------
00432181   1/1  Gleefa.......sggekqrvalalallreadvlllvvdadeptsfldle....ll--------------
00437921   1/1  ...........................kpdvlllDEi.drldpdaqnallklleel.pagv---------
00515351   1/1  ildglsggllqrvallrallrpdlvifldapleelleRllkRd.dseeeiler-----------------
00513251   1/1  ............gqkqrvalleaalkegylvvvDet..gldraqrlellelardlgrpvlviflatspev
00499331   1/1  aggkvvildgfpggllqrealrrllprpdlvilldappeelleRllkrgrldgreddslellekrlerye
00416171   1/1  ekgafgggekqrlgllrla..dggvlflDEidkl.....dpdvqnaLlrvleegeltrlgggivlpadvr
00402371   1/1  ....vrldasellefgkyvgafegglrqllglaraa..kpgvlflDEidsllgarggsg-----------
00461621   1/1  ..kpavlsggrkqrlalaralavdpe.lildgrllgr.rllplpdlvifld-------------------
00519581   1/1  ......dleaverhlldiaeellengeilildeptvgldsk...dildelakilkevnf-----------
00386741   1/1  ..pfvrldaselsggeklrgllarala.kpgvlllDEida.ldpdvqeallelleegel-----------
00476071   1/1  ...ldglvygvlqdrllerllaagpdvlildgpl.lldvellplpdlvifldappevlleRllkRggdsl
00437901   1/1  .......................................vddlsgyvgelsggeklrellae--------
00517691   1/1  rergitidvalarllldgrkilllDtPGhedfvkevlralrladgallvvdadegv--------------
00378841   1/1  vpiilvgnKiDllgrqvlveearalakelgiplf..etSaktgegvdelfe-------------------
00367291   1/1  .........selleklvgegegrlrgalaealradpgvlflDEidalagkrgsgtsrld-----------
00521551   1/1  .........elvgkyvgelegglrqllalaraa..npgvlflDEidklapkrsptsgld-----------
00533151   1/1  largpvvildgfpggllqrealrrlllrpdlvifldapleelleRllkrgrlirleddseevlekrlery
00430121   1/1  vselighppg.yvGedelgvlfeaarkappsvlllDEidkl.....dpdvlnaLlqlle-----------
00478081   1/1  .eglllsdefrelleealalladgdvvilDgfgrlldarqlleelllllleepppdlvifldadpevlle
00457851   1/1  dgfpldlegaealreallragplpdlvifldapleelleRllkrgreplddteevilkrlerlrelyerl
00472911   1/1  fedaleagfrqrladlirallakgkvvild..gtglsreareellellkelg..pvlvif----------
00482721   1/1  ellaelsggqgdvliiegalllepgllplpdlvifld---------------------------------
00516041   1/1  kgkvvildgtgrlleldealellgpdlvifldappeelleRllkrgldeeaieerlerlreilepleead
00496061   1/1  gfpldlegalllrealarallpdl.vifldapleelleRllkrgrllereddseevlekrlerylelyer
00478391   1/1  ...............llakgkvvildgtnlsealdealrrllrpdlvifldapleelleRllkrgrhpes
00469161   1/1  lsggerqrlaidlegalllerllldepf------------------------------------------
00473941   1/1  lg..esdlrggfkqa........akpgvlflDEidrl.....drevqnaLlelleelqv-----------
00482661   1/1  lflkgpellldlglpkgrg..llLyGPpGtGKTtlakalanel...ggpvi..........---------
00410531   1/1  taGqerfrsllarylrgadgillvvdatdglsfeevaklleellglaglegvpiilvgnKlDlldalllr
00495771   1/1  ----------------------------------------------------------------------
00487061   1/1  gfgepdafdnellgellealleggkivlsarraqlleirlirpllaeg----------------------
00418301   1/1  firvdaselteaelvGyesgarlrelfaragigllaladpgvlflDEidkllpargssg-----------
00410321   1/1  ----------------------------------------------------------------------
00409841   1/1  .............vlldgrdllllDtPGlidfaseptnlldle---------------------------
00489391   1/1  ..................aegkvvildgtg..ldieqrealrelllel.prpdlvifldadpeel-----
00457881   1/1  fprdleqaealrallaelglppdlvifldaplevlleRllkrgddpeealekrlklyepllelyeeadyl
00493171   1/1  ldgfpv.lldgalqlllllrelllkpdlvilldvslevlleRllkRgrdseevikkrleryleet.plid
00509891   1/1  dlagaleel.laralaggpdviliEgagllplpliel---------------------------------
00471271   1/1  ----------------------------------------------------------------------
00401211   1/1  lergitikigaasllldklaivsdtpgttldpilgvleldgpkllllDtPGhedflkel-----------


                         -         -         -         +         -         -         -:280
query           LFVEDGQILFQGPKDDFFNSDNQRIKNFLSAMTLSNLD--------------------------------
00390411   1/1  eaekakalleelkele------------------------------------------------------
00509431   1/1  igplldglellvglnglldrplselSgGek----------------------------------------
00367901   1/1  ellellglgglldrpv------------------------------------------------------
00379581   1/1  vthdldealrladrilvlddG-------------------------------------------------
00422801   1/1  lrelak.gltvllvth------------------------------------------------------
00378981   1/1  drilvlddGrivelgtpeellenpaslyta----------------------------------------
00361211   1/1  vilvthdldlldsallrpgkrpllsdlrgsgeie------------------------------------
00440861   1/1  pglvvlisaltgegldeltvrenlalg-------------------------------------------
00475891   1/1  ladrilvlddGrivelgtpeel------------------------------------------------
00500441   1/1  rladrilvlddGrivelgtpeellenpkslyt--------------------------------------
00420701   1/1  ladrilvlddGrivelgtpeellenpaslyt---------------------------------------
00425571   1/1  ilvlddGrivelgtpeellenpaslytaell---------------------------------------
00482201   1/1  rladrilvlddGrivelgtpeellenpgllytll------------------------------------
00490801   1/1  traellellrelakegktvllv------------------------------------------------
00466931   1/1  LSGGerqrvalarala------------------------------------------------------
00510251   1/1  petraellellrelakegktvl------------------------------------------------
00502741   1/1  rilvlddGrivelgtpeellenpgllytllllgsl-----------------------------------
00404101   1/1  lrladrilvlddGrivelgtpeellenpl-----------------------------------------
00482261   1/1  l.ladrilvlddGrivelgtpeellenpgllytll-----------------------------------
00466971   1/1  lrladrilvlddGrive-----------------------------------------------------
00475991   1/1  vllvtHdlsealrladrilvld------------------------------------------------
00530591   1/1  gltvllvtHdlseal.ladril------------------------------------------------
00458601   1/1  llvtHdldealrladrilvl--------------------------------------------------
00495371   1/1  dleeveeladrvavlaggri--------------------------------------------------
00436071   1/1  rivv------------------------------------------------------------------
00485451   1/1  lvthdlreae..adrilvlrkg------------------------------------------------
00424961   1/1  alDgeivlslllalkrl-----------------------------------------------------
00500611   1/1  vthdlreveeladkrdrvvv--------------------------------------------------
00372301   1/1  dlelaalladrvvvlndgr---------------------------------------------------
00469451   1/1  ........Asdrvlvlrdgrivevg---------------------------------------------
00498251   1/1  llrrllrlakelgvtvllvthdl-----------------------------------------------
00488521   1/1  lakelgvtvllvthdlde----------------------------------------------------
00496111   1/1  leeaedladsgriavl------------------------------------------------------
00367481   1/1  lvvtHdlelaalaadriv----------------------------------------------------
00436511   1/1  ----------------------------------------------------------------------
00468691   1/1  gldalre..ilellrellkelg------------------------------------------------
00422141   1/1  ...ieyvfqspnlfpl.-----------------------------------------------------
00379601   1/1  ivlddGriveegtpeellan--------------------------------------------------
00495031   1/1  ilvthdlrevegrlelad----------------------------------------------------
00457311   1/1  eagrsadrvl....gri-----------------------------------------------------
00503371   1/1  kelekrlellekeleelee---------------------------------------------------
00532531   1/1  yvllsGrivesgtteelltepkatfsacfaap--------------------------------------
00448931   1/1  DllakggadlslaleladrilvlgdGe-------------------------------------------
00437981   1/1  pallsrcqvirfpplseee---------------------------------------------------
00485931   1/1  dgtakggaalslaleladrilvlgdG--------------------------------------------
00381441   1/1  ----------------------------------------------------------------------
00475521   1/1  ----------------------------------------------------------------------
00478411   1/1  ----------------------------------------------------------------------
00468601   1/1  lalrladrilvlgvGeivedgtpfell-------------------------------------------
00371631   1/1  ralvedpdvlilDgptalldpltr.ellell---------------------------------------
00414121   1/1  livlnKiDllselthdlellreladrilvlgd--------------------------------------
00464791   1/1  Eptsgldal..r----------------------------------------------------------
00515511   1/1  ----------------------------------------------------------------------
00356411   1/1  ----------------------------------------------------------------------
00515531   1/1  ----------------------------------------------------------------------
00462761   1/1  ieevadrilallegrlvl----------------------------------------------------
00477971   1/1  il--------------------------------------------------------------------
00475371   1/1  adrilvldlg------------------------------------------------------------
00426051   1/1  lerlarey--------------------------------------------------------------
00368501   1/1  ellkalkeaeaeellellgl--------------------------------------------------
00478441   1/1  ----------------------------------------------------------------------
00480471   1/1  ----------------------------------------------------------------------
00475381   1/1  ----------------------------------------------------------------------
00533501   1/1  ellekad.rvvvidag.....gsleevveeilellee---------------------------------
00510561   1/1  eilrllkrlakel---------------------------------------------------------
00508671   1/1  ----------------------------------------------------------------------
00512891   1/1  allrrgrivelgplse------------------------------------------------------
00437941   1/1  eldpallsRfdviefpppdeeel-----------------------------------------------
00387201   1/1  ----------------------------------------------------------------------
00493431   1/1  aleelldiivvlllglilqpgsll----------------------------------------------
00496571   1/1  adrlialyegavvvidasglsleevveeil----------------------------------------
00503741   1/1  lrlleegkltdkllgl------------------------------------------------------
00464411   1/1  ddvvvidan.....gsieevveeilklie-----------------------------------------
00487021   1/1  ----------------------------------------------------------------------
00379961   1/1  ----------------------------------------------------------------------
00368571   1/1  lrdladrleklva---------------------------------------------------------
00468951   1/1  deptgellgl------------------------------------------------------------
00490731   1/1  ilvlleglgvpgvvlNkldlvaegga--------------------------------------------
00498531   1/1  lreilrllkrlak---------------------------------------------------------
00434401   1/1  rlgr------------------------------------------------------------------
00489571   1/1  rvavldd......Gtpeellarpanpyvrell--------------------------------------
00484101   1/1  ----------------------------------------------------------------------
00379261   1/1  lddv------------------------------------------------------------------
00477011   1/1  ----------------------------------------------------------------------
00404191   1/1  aergv-----------------------------------------------------------------
00439861   1/1  alaggga---------------------------------------------------------------
00532471   1/1  ----------------------------------------------------------------------
00499191   1/1  adl-------------------------------------------------------------------
00480441   1/1  alelllaillal----------------------------------------------------------
00444381   1/1  pgilflDEidkllddrgea---------------------------------------------------
00451571   1/1  ----------------------------------------------------------------------
00511381   1/1  sllL------------------------------------------------------------------
00513761   1/1  lklgipiilvlnKlDlls----------------------------------------------------
00489631   1/1  ivtddl...-------------------------------------------------------------
00498811   1/1  dlsleevvdril----------------------------------------------------------
00392701   1/1  tnrpeeld--------------------------------------------------------------
00406781   1/1  tndlee----------------------------------------------------------------
00470731   1/1  ----------------------------------------------------------------------
00405881   1/1  delldailellkgk--------------------------------------------------------
00480251   1/1  lsvalilglpilflgtgenvddlevfnpgelvd-------------------------------------
00482551   1/1  ----------------------------------------------------------------------
00527261   1/1  ----------------------------------------------------------------------
00420941   1/1  ----------------------------------------------------------------------
00394721   1/1  ----------------------------------------------------------------------
00432181   1/1  ----------------------------------------------------------------------
00437921   1/1  ----------------------------------------------------------------------
00515351   1/1  ----------------------------------------------------------------------
00513251   1/1  lierlldrvllldegslvd---------------------------------------------------
00499331   1/1  eltrdlielyeeadrvividag.....lsieevveei---------------------------------
00416171   1/1  l---------------------------------------------------------------------
00402371   1/1  ----------------------------------------------------------------------
00461621   1/1  ----------------------------------------------------------------------
00519581   1/1  ----------------------------------------------------------------------
00386741   1/1  ----------------------------------------------------------------------
00476071   1/1  eeie------------------------------------------------------------------
00437901   1/1  ----------------------------------------------------------------------
00517691   1/1  ----------------------------------------------------------------------
00378841   1/1  ----------------------------------------------------------------------
00367291   1/1  ----------------------------------------------------------------------
00521551   1/1  ----------------------------------------------------------------------
00533151   1/1  lklyerli--------------------------------------------------------------
00430121   1/1  ----------------------------------------------------------------------
00478081   1/1  RllkRg----------------------------------------------------------------
00457851   1/1  iepyeead--------------------------------------------------------------
00472911   1/1  ----------------------------------------------------------------------
00482721   1/1  ----------------------------------------------------------------------
00516041   1/1  dlvidtanldl-----------------------------------------------------------
00496061   1/1  liepykkadyvi----------------------------------------------------------
00478391   1/1  eevle-----------------------------------------------------------------
00469161   1/1  ----------------------------------------------------------------------
00473941   1/1  ----------------------------------------------------------------------
00482661   1/1  ----------------------------------------------------------------------
00410531   1/1  evsaelalelakelgikfie--------------------------------------------------
00495771   1/1  ----------------------------------------------------------------------
00487061   1/1  ----------------------------------------------------------------------
00418301   1/1  ----------------------------------------------------------------------
00410321   1/1  ----------------------------------------------------------------------
00409841   1/1  ----------------------------------------------------------------------
00489391   1/1  ----------------------------------------------------------------------
00457881   1/1  ividasl---------------------------------------------------------------
00493171   1/1  yydl------------------------------------------------------------------
00509891   1/1  ----------------------------------------------------------------------
00471271   1/1  ----------------------------------------------------------------------
00401211   1/1  ----------------------------------------------------------------------