[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for lsal0:ABE00433.1


[Show Plain Result]

## Summary of Sequence Search
   1::122
   2::108  0.00048 26.4% 0042268 00422681 1/1   omain of mannose transporter, IIA-Man   
   1::122


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MSLGITIVSHVYEVANGLPRLLTQVAKDVPITTAGGTEDNDVGTSMEKIMNAFEENDADEILAFYDLGSA
00422681   1/1  -migiilvsHgn.lAsgllssaemllgeqenvaavdllpdedledllekleealeeldsgegvliLtDll


                         -         -         *         -         -         -         -:140
query           KMNLEMAIEMTDKKVHLYDVALIEGAYTAATLLEAGVDLQEVEKQLEPLKIK------------------
00422681   1/1  GGspfnlallllletgnvevisgvnlpllleallarll--------------------------------