[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for lsal0:ABE00441.1


[Show Plain Result]

## Summary of Sequence Search
   1::643
 305::558  1.5e-40 37.8% 0048396 00483961 1/1   ike                                     
 315::563  5.2e-37 27.8% 0048428 00484281 1/1   ike                                     
 311::560  5.4e-33 31.8% 0047540 00475401 1/1   ike                                     
 313::569  1.7e-32 27.6% 0050690 00506901 1/1   ike                                     
 313::560  7.8e-31 41.2% 0051937 00519371 1/1   ike                                     
 314::564  1.9e-30 27.8% 0041356 00413561 1/1   ike                                     
 313::565  7.4e-30 28.8% 0047938 00479381 1/1   ike                                     
 310::584  5.9e-29 32.6% 0047721 00477211 1/1   ike                                     
 314::562  3.1e-28 37.0% 0043763 00437631 1/1   ike                                     
 313::563  4.7e-28 26.2% 0049203 00492031 1/1   ike                                     
 313::563  6.1e-28 27.9% 0049302 00493021 1/1   ike                                     
 313::569  1.1e-27 29.8% 0049197 00491971 1/1   ike                                     
 315::570  5.7e-25 26.7% 0044171 00441711 1/1   ike                                     
 320::438  1.3e-23 40.8% 0051938 00519381 1/1    cation-transporting ATPase, ATP-bindin 
 311::572    2e-22 25.7% 0052665 00526651 1/1   ike                                     
 329::443  2.6e-22 36.5% 0044221 00442211 1/1    cation-transporting ATPase, ATP-bindin 
 119::217  1.1e-20 34.3% 0049471 00494711 1/1   um ATPase, transduction domain A        
 311::560  3.4e-19 30.9% 0043284 00432841 1/1   ike                                     
 314::560  9.7e-19 31.4% 0051348 00513481 1/1   ike                                     
 313::574  2.4e-18 25.9% 0052186 00521861 1/1   ike                                     
 311::532    6e-15 27.7% 0051120 00511201 1/1   ike                                     
 314::559  4.6e-14 24.1% 0037518 00375181 1/1   ike                                     
 314::559  3.7e-12 28.5% 0045131 00451311 1/1   ike                                     
  45::636  4.8e-11 17.5% 0049473 00494731 1/1   um ATPase, transmembrane domain M       
 314::539  2.4e-09 24.6% 0051058 00510581 1/1   ike                                     
 313::548  2.9e-09 19.2% 0051800 00518001 1/1   ike                                     
 315::555  2.5e-07 19.7% 0046572 00465721 1/1   ike                                     
 313::559    3e-07 24.5% 0053006 00530061 1/1   ike                                     
 305::560  5.2e-07 30.1% 0051888 00518881 1/1   ike                                     
 308::534  6.7e-07 25.6% 0040657 00406571 1/1   ike                                     
 313::531  6.4e-06 27.2% 0050761 00507611 1/1   ike                                     
 311::545  1.5e-05 22.8% 0049814 00498141 1/1   ike                                     
 313::547  8.3e-05 24.3% 0049067 00490671 1/1   ike                                     
 311::560  0.00011 23.4% 0053041 00530411 1/1   ike                                     
 310::559  0.00026 22.9% 0052884 00528841 1/1   ike                                     
 505::547  0.00026 40.5% 0052765 00527651 1/1   ike                                     
   1::643


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MSLIKRMSPDEKKESGVIALCLMLLILAHFIPKNITIVLYIVTYIISAYPILKEAIENIFHGKWFDENFL
00483961   1/1  ----------------------------------------------------------------------
00484281   1/1  ----------------------------------------------------------------------
00475401   1/1  ----------------------------------------------------------------------
00506901   1/1  ----------------------------------------------------------------------
00519371   1/1  ----------------------------------------------------------------------
00413561   1/1  ----------------------------------------------------------------------
00479381   1/1  ----------------------------------------------------------------------
00477211   1/1  ----------------------------------------------------------------------
00437631   1/1  ----------------------------------------------------------------------
00492031   1/1  ----------------------------------------------------------------------
00493021   1/1  ----------------------------------------------------------------------
00491971   1/1  ----------------------------------------------------------------------
00441711   1/1  ----------------------------------------------------------------------
00519381   1/1  ----------------------------------------------------------------------
00526651   1/1  ----------------------------------------------------------------------
00442211   1/1  ----------------------------------------------------------------------
00494711   1/1  ----------------------------------------------------------------------
00432841   1/1  ----------------------------------------------------------------------
00513481   1/1  ----------------------------------------------------------------------
00521861   1/1  ----------------------------------------------------------------------
00511201   1/1  ----------------------------------------------------------------------
00375181   1/1  ----------------------------------------------------------------------
00451311   1/1  ----------------------------------------------------------------------
00494731   1/1  --------------------------------------------eldlhalsveevlkllntdlekGLss
00510581   1/1  ----------------------------------------------------------------------
00518001   1/1  ----------------------------------------------------------------------
00465721   1/1  ----------------------------------------------------------------------
00530061   1/1  ----------------------------------------------------------------------
00518881   1/1  ----------------------------------------------------------------------
00406571   1/1  ----------------------------------------------------------------------
00507611   1/1  ----------------------------------------------------------------------
00498141   1/1  ----------------------------------------------------------------------
00490671   1/1  ----------------------------------------------------------------------
00530411   1/1  ----------------------------------------------------------------------
00528841   1/1  ----------------------------------------------------------------------
00527651   1/1  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           MSVATVGALAIGQFSEAIAVMLFYRVGEIFEDLAIENSKKSITNLLDIRPEYANLELNGKLQQVKPELLN
00483961   1/1  ----------------------------------------------------------------------
00484281   1/1  ----------------------------------------------------------------------
00475401   1/1  ----------------------------------------------------------------------
00506901   1/1  ----------------------------------------------------------------------
00519371   1/1  ----------------------------------------------------------------------
00413561   1/1  ----------------------------------------------------------------------
00479381   1/1  ----------------------------------------------------------------------
00477211   1/1  ----------------------------------------------------------------------
00437631   1/1  ----------------------------------------------------------------------
00492031   1/1  ----------------------------------------------------------------------
00493021   1/1  ----------------------------------------------------------------------
00491971   1/1  ----------------------------------------------------------------------
00441711   1/1  ----------------------------------------------------------------------
00519381   1/1  ----------------------------------------------------------------------
00526651   1/1  ----------------------------------------------------------------------
00442211   1/1  ----------------------------------------------------------------------
00494711   1/1  ------------------------------------------------lpptalvlrdgklvevpaeelv
00432841   1/1  ----------------------------------------------------------------------
00513481   1/1  ----------------------------------------------------------------------
00521861   1/1  ----------------------------------------------------------------------
00511201   1/1  ----------------------------------------------------------------------
00375181   1/1  ----------------------------------------------------------------------
00451311   1/1  ----------------------------------------------------------------------
00494731   1/1  eeaeerlekyGpNelpekkyksflkllleqflnpf.......nliLlvaailslilglllegegelvdyi
00510581   1/1  ----------------------------------------------------------------------
00518001   1/1  ----------------------------------------------------------------------
00465721   1/1  ----------------------------------------------------------------------
00530061   1/1  ----------------------------------------------------------------------
00518881   1/1  ----------------------------------------------------------------------
00406571   1/1  ----------------------------------------------------------------------
00507611   1/1  ----------------------------------------------------------------------
00498141   1/1  ----------------------------------------------------------------------
00490671   1/1  ----------------------------------------------------------------------
00530411   1/1  ----------------------------------------------------------------------
00528841   1/1  ----------------------------------------------------------------------
00527651   1/1  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           KGDIIIVNPGEKIAVDGVVESGEAYLNTAALTGETNPLLVTKDSQVLSGMIVENSALRIRVSKEYKDSTV
00483961   1/1  ----------------------------------------------------------------------
00484281   1/1  ----------------------------------------------------------------------
00475401   1/1  ----------------------------------------------------------------------
00506901   1/1  ----------------------------------------------------------------------
00519371   1/1  ----------------------------------------------------------------------
00413561   1/1  ----------------------------------------------------------------------
00479381   1/1  ----------------------------------------------------------------------
00477211   1/1  ----------------------------------------------------------------------
00437631   1/1  ----------------------------------------------------------------------
00492031   1/1  ----------------------------------------------------------------------
00493021   1/1  ----------------------------------------------------------------------
00491971   1/1  ----------------------------------------------------------------------
00441711   1/1  ----------------------------------------------------------------------
00519381   1/1  ----------------------------------------------------------------------
00526651   1/1  ----------------------------------------------------------------------
00442211   1/1  ----------------------------------------------------------------------
00494711   1/1  vGDivllkagdrvPaDgvllegsdglllvdesaLTGEslpvlktalllldedlllldlgnlvfagtlvls
00432841   1/1  ----------------------------------------------------------------------
00513481   1/1  ----------------------------------------------------------------------
00521861   1/1  ----------------------------------------------------------------------
00511201   1/1  ----------------------------------------------------------------------
00375181   1/1  ----------------------------------------------------------------------
00451311   1/1  ----------------------------------------------------------------------
00494731   1/1  dalvillvvlinaiigfvqeyraekalealknllap..................................
00510581   1/1  ----------------------------------------------------------------------
00518001   1/1  ----------------------------------------------------------------------
00465721   1/1  ----------------------------------------------------------------------
00530061   1/1  ----------------------------------------------------------------------
00518881   1/1  ----------------------------------------------------------------------
00406571   1/1  ----------------------------------------------------------------------
00507611   1/1  ----------------------------------------------------------------------
00498141   1/1  ----------------------------------------------------------------------
00490671   1/1  ----------------------------------------------------------------------
00530411   1/1  ----------------------------------------------------------------------
00528841   1/1  ----------------------------------------------------------------------
00527651   1/1  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           VKILELVQNASEKKTKTENFITKFSQIYTPVIVISAIMLASIPPLFLGQEFQVWLYRALIFLVISCPCAL
00483961   1/1  ----------------------------------------------------------------------
00484281   1/1  ----------------------------------------------------------------------
00475401   1/1  ----------------------------------------------------------------------
00506901   1/1  ----------------------------------------------------------------------
00519371   1/1  ----------------------------------------------------------------------
00413561   1/1  ----------------------------------------------------------------------
00479381   1/1  ----------------------------------------------------------------------
00477211   1/1  ----------------------------------------------------------------------
00437631   1/1  ----------------------------------------------------------------------
00492031   1/1  ----------------------------------------------------------------------
00493021   1/1  ----------------------------------------------------------------------
00491971   1/1  ----------------------------------------------------------------------
00441711   1/1  ----------------------------------------------------------------------
00519381   1/1  ----------------------------------------------------------------------
00526651   1/1  ----------------------------------------------------------------------
00442211   1/1  ----------------------------------------------------------------------
00494711   1/1  gsllgvV---------------------------------------------------------------
00432841   1/1  ----------------------------------------------------------------------
00513481   1/1  ----------------------------------------------------------------------
00521861   1/1  ----------------------------------------------------------------------
00511201   1/1  ----------------------------------------------------------------------
00375181   1/1  ----------------------------------------------------------------------
00451311   1/1  ----------------------------------------------------------------------
00494731   1/1  ..............................................................vrselkpt
00510581   1/1  ----------------------------------------------------------------------
00518001   1/1  ----------------------------------------------------------------------
00465721   1/1  ----------------------------------------------------------------------
00530061   1/1  ----------------------------------------------------------------------
00518881   1/1  ----------------------------------------------------------------------
00406571   1/1  ----------------------------------------------------------------------
00507611   1/1  ----------------------------------------------------------------------
00498141   1/1  ----------------------------------------------------------------------
00490671   1/1  ----------------------------------------------------------------------
00530411   1/1  ----------------------------------------------------------------------
00528841   1/1  ----------------------------------------------------------------------
00527651   1/1  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           VISIPLSYFGGIGASSRAGILVKGSNYLEALSQAKAVIFDKTGTLTRGEFFVTQIIPANGVSKKEIVKLA
00483961   1/1  ------------------------lnaletlgsiklvvfDkDGTLtdgep....................
00484281   1/1  ----------------------------------iklivfDlDGTLtdgdptisd.atlealkelrelgi
00475401   1/1  ------------------------------lgkiklivfDlDGTLtdsetiea.................
00506901   1/1  --------------------------------miklilfDlDGTLtdsehliaealiealaelaek.gip
00519371   1/1  --------------------------------kiklvvfDkdGTLtdg......................
00413561   1/1  ---------------------------------MikliafDlDGTLldsdktiseet.............
00479381   1/1  --------------------------------HkiklilfDlDGTLtdsdpti.................
00477211   1/1  -----------------------------rlakiklvvfDlDGTLtdgepll..................
00437631   1/1  ---------------------------------ikliafDldgtllgli.....................
00492031   1/1  --------------------------------mikliafDlDGTLldndmtvslpetiealkklkekgik
00493021   1/1  --------------------------------MkiklilfDlDGTLldgdplipaliea...........
00491971   1/1  --------------------------------kiklvvfDlDGTLtdedi....................
00441711   1/1  ----------------------------------kliflDlDGTLldivpdpddvvispealealkalae
00519381   1/1  ---------------------------------------DKTGTLTlGkpev............ellala
00526651   1/1  ------------------------------lkkkklvifDfDGTltdsdsidelaellg.gpevaaltel
00442211   1/1  ------------------------------------------------kpvvtdvlplggvseeellala
00494711   1/1  ----------------------------------------------------------------------
00432841   1/1  ------------------------------MkkiklilfDlDGTLldsd.....................
00513481   1/1  ---------------------------------ikliafDlDGTLldne.....................
00521861   1/1  --------------------------------dparlldlllklvmkgmkiklviFDlDGTLldfdsepl
00511201   1/1  ------------------------------lmmikliafDlDGTLldsdkyispeaiealkalrea.gik
00375181   1/1  ---------------------------------mikaviFDlDGTLvdseplv.................
00451311   1/1  ---------------------------------MikavlfDldGTLv.......................
00494731   1/1  plqrklnrlakllliillvlallvfivllirfllllrggdwlegflnallfavalavaaiPegLpavvti
00510581   1/1  ---------------------------------ikllvlDlDGTLldsd.....................
00518001   1/1  --------------------------------MkikliafDlDGTLldsdktispeaiealkrlaek..i
00465721   1/1  ----------------------------------kavlFDlDGTLv..e.....................
00530061   1/1  --------------------------------MkikaviFDlDGTLv.......................
00518881   1/1  ------------------------lllllllmmikliafDlDGTLlds......................
00406571   1/1  ---------------------------nlllkkikavifDlDGTLldsepllhyaleea...........
00507611   1/1  --------------------------------mikliafDlDgTLldgd.....ispe............
00498141   1/1  ------------------------------MlkkikavifDlDgTLvdseplllealdelleelglelll
00490671   1/1  --------------------------------iklvlfDlDGtLlnddklipgakealkelkkgikvvia
00530411   1/1  ------------------------------lmmikaviFDlDGTLv........................
00528841   1/1  -----------------------------MslskikavlFDlDGTLvdsepliaealnelleelglpldl
00527651   1/1  ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           AIAESSSPHPIARSIVKNYPGNIARVSNVEELVGLGVRAEYQGDTISVGNMKLMNKLNIDGVSTIEDTTG
00483961   1/1  .......idelakalgle........eeveeltglglegeldfrevllgrlallagl.............
00484281   1/1  avvlatgrplaailellkelgldlpliaenGalifdld...gtlilaevldeelllgllellaelglrvl
00475401   1/1  ............................lkelagkgirvllatgrallglldlleelgldla........
00506901   1/1  vvivtgrpleellellgelglrlyliaengalildpdgel..............................
00519371   1/1  ......................................................................
00413561   1/1  ..........................iealkklke.gikvviaTgrplasvlellkelgldgdpliasnG
00479381   1/1  .........spaaiaalaalaekgipvviatgrsleevlellgelglrgllialngalvlllge......
00477211   1/1  ......................................................................
00437631   1/1  ......................................................................
00492031   1/1  vviaTgrplasvlklleelglddpliaenGaliyddgevllltgldrellleilellaelglrvlaladk
00493021   1/1  ..laalekgipvvlvTgrplaeieellkelglglpd....eliaengaliyvlggevl.gllellleeyl
00491971   1/1  ............................lelaaeagir.....vtlatgrgl......ldfaellrerva
00441711   1/1  ..gikvviaTGRslaellellgl.........dlpliaenGalirdngellllllldlll..........
00519381   1/1  aalelasehPlAkAiveaakerglallevedfealpGlGv....dgklvlvGnlrlllelgillleelee
00526651   1/1  amggglsfeealrrrlellkglpeee............................................
00442211   1/1  aaaelasehPlarAivelakerglallevedfealpgvgvsavtrmsgvdvdgrrvlvGapdlllelvld
00494711   1/1  ----------------------------------------------------------------------
00432841   1/1  ......................................................................
00513481   1/1  ......................................................................
00521861   1/1  llaalnealkelgllppedldelrkllglglrellaglltelalrgefeellrerlallaelglfleeye
00511201   1/1  vvlaTgrplaealplleelgldglpviaenGalvydpksll........lldgevlyelgldlelllell
00375181   1/1  ......................iaealnealeelglplsleeirsliglglrellralleelgvllllle
00451311   1/1  ....dsepvlaaalnealeelglpldleelralvglglrellgglldfgelleealallleelgldlle.
00494731   1/1  tlalgakrlakknalvrrlsavEtlG............................................
00510581   1/1  ......................................................................
00518001   1/1  pvvivTgrplagllellgegllglpdyliaenGaliyddgellylagldaelleelldlleelllell..
00465721   1/1  .....pdiaaalnellaelglelllllleelrallgelllallrglldfeellelllellglllke...l
00530061   1/1  .................dsepliaaalnealeelglplslellrrllglglrellrrll......lleel
00518881   1/1  ......................................................................
00406571   1/1  ......................................................................
00507611   1/1  ........................tkealkklkekgikvviaTgrslaevlellkelglddpviae..nG
00498141   1/1  l.....................................................................
00490671   1/1  Tgrsylsvlelleelgllgivvtnngilvldlslgllneldlllllsllvlaeylkelllgnlvyvlged
00530411   1/1  ................dsepliaaalnealaelglpllteellrallglslrellrrllellglllglgl
00528841   1/1  eellrallgklllellrrllgrggldleellrellallleelglgldleellallldlygtllaeelelf
00527651   1/1  ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           TVVYVALNNEYFGAIEVSDMIKTDAKVAIQGLKNVGIDNVTMLTGDKKIVGKNVAEKLNIPNVKTELLPQ
00483961   1/1  ......seeellgllaledplrpgakellaalkeagik.vaivsgdnretaeaiaeklgideenvlanel
00484281   1/1  alaedalygeldfeelllealdllaglvdgvltdllidltllglialadplrpgakellaa..kagi.kv
00475401   1/1  ..llaengaevlgllaledplrpgakellealkeagik.vaivtgdnretaeaileelglddvfanvleg
00506901   1/1  ..lalaldlyllgllalld.lrpgarellaelkeagik.vaivtgdnretaeaiaeelgldfdvvvsgvf
00519371   1/1  ..............laledplrpgakealkalkeagi.kvvilTgdnlltaeaiakelgldlvfarvlpv
00413561   1/1  alvydldgevlllkgldeelllellellaelglrvlllaldgvyileedlellgllalldplrpgvkell
00479381   1/1  ...........................laledplrpgvkelleelkeagi.kvaivtgdnelllllldld
00477211   1/1  ...........lallalldrlrpgalealkalkeagi.kvaivTgrssataralleelgldevfa..ggk
00437631   1/1  ...............aiedplrpgvkeaikalreagi.kvvilTGdnlltalaiakelgidtllialngl
00492031   1/1  dgvy......................................................lekdltllglla
00493021   1/1  elleelllllll..................plrpgakel.....eagi.klaihvtlgdneetaeaiake
00491971   1/1  llaengalledlgelaledplrpgalelldalk.agik.vvivsgdftetaepiakelgldelfanvlev
00441711   1/1  .............elllellelldelkedtpgllielkelgl.kvhlltadpelleelaeelaeelgidl
00519381   1/1  llealesegktvvlvavd----------------------------------------------------
00526651   1/1  ..........llellaedlplrpgakellkklkergip.laivSggfgefiealleklglp...dyifan
00442211   1/1  lgglipseleeaveelereGkTv-----------------------------------------------
00494711   1/1  ----------------------------------------------------------------------
00432841   1/1  ..................dkispeviealaalreagik.vviaTGrpletaleiakelgldlpldyvite
00513481   1/1  .................ldkispetiealkklreagik.vviaTGrplatalaiaeelglleddpliaen
00521861   1/1  ellae.............................................................iedp
00511201   1/1  ellkelgitvllytgdg...gyialadllgldavvallalldlgilkv.lltgddellaelialllglll
00375181   1/1  llgrllleediealleellelylellaellppfpgvkelleaLkerGi.klavvTnkprelaealleelg
00451311   1/1  ............ellelyralllelplfpgvvelLealkaaGi.klailTngsrelaeallerlglddyf
00494731   1/1  ......................................................................
00510581   1/1  ............gllleelklrpgviealkklkeaGi.kiviaTgrslrtaealleklglddyvivenga
00518001   1/1  ........delyl.ertpglvieakelsltlhvrdalellkergiklliitndelleellallealglel
00465721   1/1  gldelieeflelylellaeglelypgalelleaLkaaGik.laivTngsgisrelaeallerllglddyf
00530061   1/1  leelleeflelylell.eelelfpgvlelLealka.gi.klavvTngsrelaeallealglldyfdaivt
00518881   1/1  ................ddkkispetiealkklkekgi.kvviaTGRplasvlpllkelgldlllllldpv
00406571   1/1  ................gedklypgvvellkalkarGy.klaivTgrpgelaeallellgllglfdgvvll
00507611   1/1  aliydp.geeii.....kplllelalellellkelgi.kivlvsgdnlytlkpiaellgldellaaeltg
00498141   1/1  ................leelklfpgvlellkalkergi.klaivTngsrlelaealleklglddyfdaiv
00490671   1/1  gliylklllilllllnlmmmikaviFDlDGTLvdseplileafne.........................
00530411   1/1  deeeleelleaylelylellleelrlypgvlelLealkargik.lavvTngprelaeallealglddyfd
00528841   1/1  pgalelLeaLk.agiklaivTngsrelaeallerlglddyfdgvvtsddvg...................
00527651   1/1  ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:560
query           DKVTEVERIKSEIGDKGKVIFVGDGLNDTPVLASADVGVAMGALGSDAAVEVADVVLMKDNPTAVTRVIK
00483961   1/1  efddggyftgivtvdarvlpkpKpeivkllleklg.peevlmvGDgvnDlpalkaadvgiavg..gtd--
00484281   1/1  viltgdnlleetaeaiakelgidelfdvvlsgdvfaevkpegvdKgealkalleklgidgeevamvGDgv
00475401   1/1  ddgrstglvleivvkpkpKpeallalleklgidpeevlavGDgvnDlpmlkaagvgiamn..gtdvlkea
00506901   1/1  aevlpekpdKpeallallerlgvdpeevlmvGDgvnDlpalkaagvgvavg.ngtdvakeaadyvllddd
00519371   1/1  dKaaavkllla....geevaavGDglnDlpalkaagvgvamg.natdvakeaadivlldndllgvllale
00413561   1/1  eelkkagi.kvaiitgdneelaellailkelgldyfdvvlsgdvfleikpkgvdKgealkalleklgidp
00479381   1/1  letaeaiakelgdlfdvvlsgdvvaevkpdgvdKpealeallerlgldpeevlmvGDgvnDlpalka.gv
00477211   1/1  pkpkallalleelglspeevaavGDginDlpalaaaglgvavg.natdevkeaadyvllsndldgvaral
00437631   1/1  vltgkllellldelllellldavvfarvspedKaeavkal...gisgevvaavGDgvNDapalkaAdvgv
00492031   1/1  lldplrpgvvealeelkdagi.kvaiitgdneeldeaeailkelgidlvdvvlsggvfldilpkgvdKge
00493021   1/1  llsllpgldevfsgvvgaevlpegkpKpealeallerlgidpeevlmvGDglnDipmlkaagvgvavg.n
00491971   1/1  ddsgltvleikpspeqKaealealg...idgeeviavGDgaNDlpmlkaAglgvam..nakdavkeaady
00441711   1/1  vvvlsgklvlevlpkgvnKgsavkrlleelg....vlavGDglnDeemleaanlgvgvamgna.....ke
00519381   1/1  ----------------------------------------------------------------------
00526651   1/1  ellfddggltgvvlgadvfgrrkpkpelkleileelgldpeevimiGDgvnDleaakaadlgiamgg.gk
00442211   1/1  ----------------------------------------------------------------------
00494711   1/1  ----------------------------------------------------------------------
00432841   1/1  ngaliydlkdgevlllkgldeelleellelllelgldlllesldgayieeknealaylaelllllplypg
00513481   1/1  Galvyddgevlllkpldlellleilellkelglllllysgdglyvlllldelllllllllllpllevvdl
00521861   1/1  lrpgakellealkaaGi.klaivTggprefaeaileklglddyfdvvvgsdlevdedgeltglvedvvfg
00511201   1/1  vvvsggrfleilpkgvsKgaalklllellgillssleeviaf----------------------------
00375181   1/1  ledyffdvivtaddvpagKPdPeillkaleelg...vepleevlmvGDslnDiqaaraAGmttvgvatg-
00451311   1/1  davlssddvgvaKPdpeiyllalerlgv...dpeevlfvgDslndilaakaaGmrtvgvarggngldel-
00494731   1/1  ......................................................................
00510581   1/1  lvhdkpydelllrlpidleevlaiGDslndiemlkaaglgvalvnagde---------------------
00518001   1/1  gldvvlsgd...............ivleilpkgvdKgtalkal...lgidpeevlaiG------------
00465721   1/1  dgivtsddvgagKPdpeifllalerlgvdpeevlfvGDslnDieaakaaGlrtvlvlrggnaaee-----
00530061   1/1  sddvgrgKPdpdifllalerlgv...dpeeclmvGDslndieaakaaGmrtvgvatgyapeeel.agad-
00518881   1/1  iaenGaliydldgeviysklldlelvleilellkelgilillytldgayilllldnllelllleltllgl
00406571   1/1  ngallllgdevilrkpdpeiklellkellgldpeevlavGDsln--------------------------
00507611   1/1  ldglllllalereilkillflddelleeladalsvvrsggr-----------------------------
00498141   1/1  ssddpkpeiylkaleklgldpeevlfvgDslndieaakaaGlktvlvnrgytlke---------------
00490671   1/1  ..............ealeelglelldleelrrliglgleeileellg......lsee-------------
00530411   1/1  aivssddvgvgKPdpeifllalerlgv...dpeevlmvGDslnDilaAkaaGmrtvgvargy.gpleele
00528841   1/1  ......................vgKPdpeiyllalerlgvdpeevlmvGDslenDieaakaaGlrltvl-
00527651   1/1  --------------sleevlafGDktleggNDlemlelaglgvamgn.apeevkela-------------


                         -         -         -         *         -         -         -:630
query           IARKTKMIVWENIIFALMVKVIFLLVGALGIATMWEAVFADVGVTFIAILNALRLLKMKEENKKINKYPH
00483961   1/1  ----------------------------------------------------------------------
00484281   1/1  NDl-------------------------------------------------------------------
00475401   1/1  ----------------------------------------------------------------------
00506901   1/1  ldgvleale-------------------------------------------------------------
00519371   1/1  ----------------------------------------------------------------------
00413561   1/1  eevl------------------------------------------------------------------
00479381   1/1  lgiav-----------------------------------------------------------------
00477211   1/1  eellllargtlrlilqnlllally----------------------------------------------
00437631   1/1  Am--------------------------------------------------------------------
00492031   1/1  alk-------------------------------------------------------------------
00493021   1/1  gtd-------------------------------------------------------------------
00491971   1/1  vllsndldg-------------------------------------------------------------
00441711   1/1  aAdyvl..nd------------------------------------------------------------
00519381   1/1  ----------------------------------------------------------------------
00526651   1/1  deakeaadpvlv----------------------------------------------------------
00442211   1/1  ----------------------------------------------------------------------
00494711   1/1  ----------------------------------------------------------------------
00432841   1/1  ----------------------------------------------------------------------
00513481   1/1  ----------------------------------------------------------------------
00521861   1/1  kpkpeallealerl--------------------------------------------------------
00511201   1/1  ----------------------------------------------------------------------
00375181   1/1  ----------------------------------------------------------------------
00451311   1/1  ----------------------------------------------------------------------
00494731   1/1  .................................................................GRriy
00510581   1/1  ----------------------------------------------------------------------
00518001   1/1  ----------------------------------------------------------------------
00465721   1/1  ----------------------------------------------------------------------
00530061   1/1  ----------------------------------------------------------------------
00518881   1/1  ----------------------------------------------------------------------
00406571   1/1  ----------------------------------------------------------------------
00507611   1/1  ----------------------------------------------------------------------
00498141   1/1  ----------------------------------------------------------------------
00490671   1/1  ----------------------------------------------------------------------
00530411   1/1  ----------------------------------------------------------------------
00528841   1/1  ----------------------------------------------------------------------
00527651   1/1  ----------------------------------------------------------------------


                         -         +         -         -         -         -         *:700
query           SKTEKYKVEVNEA---------------------------------------------------------
00483961   1/1  ----------------------------------------------------------------------
00484281   1/1  ----------------------------------------------------------------------
00475401   1/1  ----------------------------------------------------------------------
00506901   1/1  ----------------------------------------------------------------------
00519371   1/1  ----------------------------------------------------------------------
00413561   1/1  ----------------------------------------------------------------------
00479381   1/1  ----------------------------------------------------------------------
00477211   1/1  ----------------------------------------------------------------------
00437631   1/1  ----------------------------------------------------------------------
00492031   1/1  ----------------------------------------------------------------------
00493021   1/1  ----------------------------------------------------------------------
00491971   1/1  ----------------------------------------------------------------------
00441711   1/1  ----------------------------------------------------------------------
00519381   1/1  ----------------------------------------------------------------------
00526651   1/1  ----------------------------------------------------------------------
00442211   1/1  ----------------------------------------------------------------------
00494711   1/1  ----------------------------------------------------------------------
00432841   1/1  ----------------------------------------------------------------------
00513481   1/1  ----------------------------------------------------------------------
00521861   1/1  ----------------------------------------------------------------------
00511201   1/1  ----------------------------------------------------------------------
00375181   1/1  ----------------------------------------------------------------------
00451311   1/1  ----------------------------------------------------------------------
00494731   1/1  dnikkf----------------------------------------------------------------
00510581   1/1  ----------------------------------------------------------------------
00518001   1/1  ----------------------------------------------------------------------
00465721   1/1  ----------------------------------------------------------------------
00530061   1/1  ----------------------------------------------------------------------
00518881   1/1  ----------------------------------------------------------------------
00406571   1/1  ----------------------------------------------------------------------
00507611   1/1  ----------------------------------------------------------------------
00498141   1/1  ----------------------------------------------------------------------
00490671   1/1  ----------------------------------------------------------------------
00530411   1/1  ----------------------------------------------------------------------
00528841   1/1  ----------------------------------------------------------------------
00527651   1/1  ----------------------------------------------------------------------