[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for lsal0:ABE00459.1


[Show Plain Result]

## Summary of Sequence Search
   1::256
   1::187  1.1e-21 27.6% 0043316 00433161 1/1   pol domain                              
   1::256


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MNRLDQVIEMVQRGLYVYPIVPNGKQPIKDYSYLKATQDIALIKRWFMDEPNINIGLNLAKSNLIIVDID
00433161   1/1  sselleyAllyaklGfsviPidpngKkPllkewqgysdatlteeeiekflksinpganialltGqdglvv


                         -         -         *         -         -         -         -:140
query           NHNNDLQAPLQSLSNLGYNLPSDYVERTKSGGLHFYYRCSDGIPATRKTKFIDGVDLLSDFVVTSPSTNY
00433161   1/1  vDvdv.kedldgl.lgellledlipktlvvtTpsGGlHiylradegvelksnpgflkkgkggvDlkalgg


                         +         -         -         -         -         *         -:210
query           KILNGATLDDIPQTPNWIIKALDNRAMPTDKMQDNPTPYRRYYTGYLIDEIVNGVDAGNRNNWIASIFGK
00433161   1/1  Yvvappsvinhglyevdkgplkgqdyttcytlvndlgeipevllell-----------------------


                         -         -         -         +         -         -         -:280
query           LLRAGASPKNAYSLLQLINDNYVQPPLPAKELDNVAESILKRFINE------------------------
00433161   1/1  ----------------------------------------------------------------------