[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for lsal0:ABE00490.1


[Show Plain Result]

## Summary of Sequence Search
   1::197
   4::76   6.9e-15 35.6% 0052655 00526551 1/1   domain-like                             
   6::76   8.6e-15 35.2% 0049910 00499101 1/1   domain-like                             
   9::75     1e-14 35.8% 0051466 00514661 1/1   domain-like                             
   7::75   1.3e-14 39.1% 0052742 00527421 1/1   domain-like                             
   7::76   1.4e-14 34.3% 0052848 00528481 1/1   domain-like                             
   8::76   1.5e-14 33.3% 0049545 00495451 1/1   domain-like                             
   9::76   1.8e-14 36.8% 0052830 00528301 1/1   domain-like                             
   8::73   2.4e-14 36.4% 0053235 00532351 1/1   domain-like                             
   8::73   3.5e-14 37.9% 0045724 00457241 1/1   domain-like                             
  10::75   3.7e-14 34.8% 0050188 00501881 1/1   domain-like                             
   8::75   3.8e-14 38.2% 0051585 00515851 1/1   domain-like                             
  10::76     4e-14 34.3% 0047677 00476771 1/1   domain-like                             
   8::75   6.1e-14 32.4% 0051514 00515141 1/1   domain-like                             
   1::76   6.2e-14 32.9% 0049195 00491951 1/1   domain-like                             
  10::75   6.6e-14 34.8% 0053204 00532041 1/1   domain-like                             
   9::76   7.1e-14 30.9% 0052393 00523931 1/1   domain-like                             
  11::76   1.6e-13 36.4% 0052877 00528771 1/1   domain-like                             
   5::72   2.1e-13 35.3% 0053096 00530961 1/1   domain-like                             
   7::75   2.2e-13 33.3% 0052647 00526471 1/1   domain-like                             
  11::76   2.4e-13 33.3% 0053065 00530651 1/1   domain-like                             
   7::76   2.8e-13 30.0% 0052798 00527981 1/1   domain-like                             
   7::73   3.9e-13 34.3% 0052845 00528451 1/1   domain-like                             
   7::75     4e-13 34.8% 0048725 00487251 1/1   domain-like                             
   7::76     7e-13 32.9% 0050079 00500791 1/1   domain-like                             
  10::76   8.4e-13 35.4% 0052843 00528431 1/1   domain-like                             
   9::76   1.5e-12 32.4% 0049392 00493921 1/1   domain-like                             
   5::76   1.6e-12 30.6% 0052885 00528851 1/1   domain-like                             
   1::75   1.3e-11 28.4% 0049523 00495231 1/1   domain-like                             
  15::76   4.2e-11 33.9% 0053202 00532021 1/1   domain-like                             
   1::197


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MHQNDLRVRKTRAKIKRALIETINEKGFGNLTVSDITERAGINRGTFYIHYKGKQDLLEQLEEAIYSDII
00526551   1/1  ---rdrrreetrerildaalelfaekgyegtsvrdiakaagvskgtlyrhFgsKedLllallerllerll
00499101   1/1  -----rrreetrerildaalelfaekgyegtsvrdiakaagvskgtlyrhFgskedLllallerllerll
00514661   1/1  --------eetreaildaalelfaekegyeglslrdiakeagvskgtlyryFkskedLllallerlleel
00527421   1/1  ------rseetreaildaalelfaekgyeattvrdiaeragvskgtlyryFpskedLllallerllerll
00528481   1/1  ------rreetrerildaalelfaekGyegtslrdiakaagvskgtlyrhFpsKedLllallerllerll
00495451   1/1  -------leetrerildaalelfaekgyegtsvrdiakaagvskgtlyryFpsKedLllallerllerll
00528301   1/1  --------eetrerildaalelfaekgyegtsvrdiaeaagvskgtlyrhFgskedLllallerllerll
00532351   1/1  -------leltrerildaalelfaekgyegtslrdiaeaagvskgtlyrhFgskedLllallerllerll
00457241   1/1  -------leltrerildaalelfaekgyegtslrdiaeaagvskgtlyrhFkskedLllallerllerll
00501881   1/1  ---------etrerildaalelfaekgyegtsvrdiakaagvskgtlyryFgskedLllallerllerll
00515851   1/1  -------reltrerileaalelfaekGyeavtlrdiaeaagvskgtlYrhFkskedLllallerllerll
00476771   1/1  ---------etrerildaalelfaekGyegtslrdiakaagvskgtlyyhFgsKedLllallerllerll
00515141   1/1  -------keetrerildaalelfaekGyegtslrdiakaagvskgtlyryFgskedLllallerllerll
00491951   1/1  lmrrrrrrreetrerildaalelfaekGyegtsvrdiakaagvskgtlyryFgsKedLllallerllerl
00532041   1/1  ---------etrerildaalelfaekgyegtslrdiakaagvskgtlyrhFgskedLllallerllerll
00523931   1/1  --------eetrerildaalelfaekGyagtslrdiaaeagvskgtlyryFgsKedLllavlerllerll
00528771   1/1  ----------trerildaalelfaekGyegtslrdiaeaagvskgtlyrhFgskedLllallerllerll
00530961   1/1  ----grrreetreaildaalelfaekgydatslreiakragvskgtlyrhFgskedLllallerllerll
00526471   1/1  ------rkeetrerildaalelfaekGyegtslrdiakaagvskgtlyrhFgsKedLllallerllerll
00530651   1/1  ----------trerildaalelfaekGyegtslrdiakaagvskgtlyryFgsKedLllallerllerll
00527981   1/1  ------kkeetrerildaAlelfaekGyegtslrdiakaagvskgtlyyyFgsKedLllavlerllerll
00528451   1/1  ------kkeltrerildaalelfaekGyeavtlrdiaeeagvskgtlyryFgskeeLllallerlleell
00487251   1/1  ------rreetrerildaalelfaekGyegtslrdiaeaagvskgtlyryFgsKedLllallerllerll
00500791   1/1  ------kreetrerildaalelfaekGyegtslrdiaeaagvskgtlyyhFpsKeaLllallerllerll
00528431   1/1  ---------ltrerileaAlelfaekGy..lslrdiakeagvskgslyrhfkskeaLllallerlleell
00493921   1/1  --------eetrerildaAlelfaekGyegtslrdiakeagvskgtlyryFpsgKedLllallerllerl
00528851   1/1  ----rrrkeetrerildaalelfaekGyaatslrdiaeeagvskgtlyryFgskeeLllallerllerll
00495231   1/1  llrrrrrrrreetrerildaAlelfaekGy.gtslrdiaaaagvskgtlyyyFgsKedLllavlerller
00532021   1/1  --------------ildaAlelfaekGyegtslrdiaeaagvskgtlyryFgsKedLllallerllerll


                         -         -         *         -         -         -         -:140
query           QLFHDNGTISSATSYEDLNRQFFQKFSAYIYGERYFILAIVLGNGDPMFYHKIKQILTRELLKRMEYLGI
00526551   1/1  elllea----------------------------------------------------------------
00499101   1/1  elleel----------------------------------------------------------------
00514661   1/1  lelle-----------------------------------------------------------------
00527421   1/1  ellee-----------------------------------------------------------------
00528481   1/1  elllea----------------------------------------------------------------
00495451   1/1  elllea----------------------------------------------------------------
00528301   1/1  elllea----------------------------------------------------------------
00532351   1/1  ell-------------------------------------------------------------------
00457241   1/1  ell-------------------------------------------------------------------
00501881   1/1  ellle-----------------------------------------------------------------
00515851   1/1  ellee-----------------------------------------------------------------
00476771   1/1  elllel----------------------------------------------------------------
00515141   1/1  ellle-----------------------------------------------------------------
00491951   1/1  lellee----------------------------------------------------------------
00532041   1/1  ellee-----------------------------------------------------------------
00523931   1/1  elllel----------------------------------------------------------------
00528771   1/1  elllea----------------------------------------------------------------
00530961   1/1  el--------------------------------------------------------------------
00526471   1/1  aalea-----------------------------------------------------------------
00530651   1/1  elllea----------------------------------------------------------------
00527981   1/1  elllea----------------------------------------------------------------
00528451   1/1  ell-------------------------------------------------------------------
00487251   1/1  ellle-----------------------------------------------------------------
00500791   1/1  elllel----------------------------------------------------------------
00528431   1/1  elleei----------------------------------------------------------------
00493921   1/1  lellle----------------------------------------------------------------
00528851   1/1  aaleaa----------------------------------------------------------------
00495231   1/1  llaal-----------------------------------------------------------------
00532021   1/1  elllea----------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           KMSDEIPHEYIEEYAIGSMLNLSIYWLEKDNPEPPNEFAKIMMRTRTKAPLAFAVKE-------------
00526551   1/1  ----------------------------------------------------------------------
00499101   1/1  ----------------------------------------------------------------------
00514661   1/1  ----------------------------------------------------------------------
00527421   1/1  ----------------------------------------------------------------------
00528481   1/1  ----------------------------------------------------------------------
00495451   1/1  ----------------------------------------------------------------------
00528301   1/1  ----------------------------------------------------------------------
00532351   1/1  ----------------------------------------------------------------------
00457241   1/1  ----------------------------------------------------------------------
00501881   1/1  ----------------------------------------------------------------------
00515851   1/1  ----------------------------------------------------------------------
00476771   1/1  ----------------------------------------------------------------------
00515141   1/1  ----------------------------------------------------------------------
00491951   1/1  ----------------------------------------------------------------------
00532041   1/1  ----------------------------------------------------------------------
00523931   1/1  ----------------------------------------------------------------------
00528771   1/1  ----------------------------------------------------------------------
00530961   1/1  ----------------------------------------------------------------------
00526471   1/1  ----------------------------------------------------------------------
00530651   1/1  ----------------------------------------------------------------------
00527981   1/1  ----------------------------------------------------------------------
00528451   1/1  ----------------------------------------------------------------------
00487251   1/1  ----------------------------------------------------------------------
00500791   1/1  ----------------------------------------------------------------------
00528431   1/1  ----------------------------------------------------------------------
00493921   1/1  ----------------------------------------------------------------------
00528851   1/1  ----------------------------------------------------------------------
00495231   1/1  ----------------------------------------------------------------------
00532021   1/1  ----------------------------------------------------------------------