[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for lsal0:ABE00528.1


[Show Plain Result]

## Summary of Sequence Search
   1::463
 147::445  2.3e-52 32.5% 0046895 00468951 1/1   p containing nucleoside triphosphate hy 
 183::448  5.3e-52 40.6% 0048255 00482551 1/1   p containing nucleoside triphosphate hy 
 180::446  1.9e-49 36.4% 0049853 00498531 1/1   p containing nucleoside triphosphate hy 
 180::453  2.5e-46 35.0% 0051056 00510561 1/1   p containing nucleoside triphosphate hy 
 180::456  8.5e-44 34.7% 0043986 00439861 1/1   p containing nucleoside triphosphate hy 
 173::448  1.3e-42 32.0% 0049503 00495031 1/1   p containing nucleoside triphosphate hy 
 170::458  3.8e-41 28.7% 0036121 00361211 1/1   p containing nucleoside triphosphate hy 
   8::121    2e-39 48.2% 0039790 00397901 1/1   minal domain of DnaB helicase           
 172::448  6.8e-38 27.2% 0049537 00495371 1/1   p containing nucleoside triphosphate hy 
 169::448  1.4e-37 30.3% 0050061 00500611 1/1   p containing nucleoside triphosphate hy 
 181::463  2.4e-26 26.3% 0049611 00496111 1/1   p containing nucleoside triphosphate hy 
 178::440  1.7e-22 27.8% 0049825 00498251 1/1   p containing nucleoside triphosphate hy 
 178::403  5.9e-22 24.4% 0046945 00469451 1/1   p containing nucleoside triphosphate hy 
 187::448  4.9e-21 26.0% 0048852 00488521 1/1   p containing nucleoside triphosphate hy 
   1::463


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MNNDIMTDNLPPQNIEAEQAVLGAIFLNTDALADAMEYVEPDDFYRRAHQILFQAMVDLNNDGEAIDVLT
00468951   1/1  ----------------------------------------------------------------------
00482551   1/1  ----------------------------------------------------------------------
00498531   1/1  ----------------------------------------------------------------------
00510561   1/1  ----------------------------------------------------------------------
00439861   1/1  ----------------------------------------------------------------------
00495031   1/1  ----------------------------------------------------------------------
00361211   1/1  ----------------------------------------------------------------------
00397901   1/1  -------lrllphnleaEqavLgallldndaldevldlLspedFylpahrlifeailellergepidlvt
00495371   1/1  ----------------------------------------------------------------------
00500611   1/1  ----------------------------------------------------------------------
00496111   1/1  ----------------------------------------------------------------------
00498251   1/1  ----------------------------------------------------------------------
00469451   1/1  ----------------------------------------------------------------------
00488521   1/1  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           VQNYLTTNNQLDDVGGVAYIAELATSVPTAANAGYYAKIVEEKSMLRRLISTATNIITQANNGDDDVPSL
00468951   1/1  ----------------------------------------------------------------------
00482551   1/1  ----------------------------------------------------------------------
00498531   1/1  ----------------------------------------------------------------------
00510561   1/1  ----------------------------------------------------------------------
00439861   1/1  ----------------------------------------------------------------------
00495031   1/1  ----------------------------------------------------------------------
00361211   1/1  ----------------------------------------------------------------------
00397901   1/1  lleelekdglleevggleylaelaentpsaanieaYaeivreksllRelie-------------------
00495371   1/1  ----------------------------------------------------------------------
00500611   1/1  ----------------------------------------------------------------------
00496111   1/1  ----------------------------------------------------------------------
00498251   1/1  ----------------------------------------------------------------------
00469451   1/1  ----------------------------------------------------------------------
00488521   1/1  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           LDSAERQIMDVSERRNRSGFREIKDVLNETLSDIDRLSQQSEDITGLPTGYREFDKMTAGLQPDNLIILA
00468951   1/1  ------lnvlgesidalgkilseilkllekgfltalgllerk.sverlstgikaLDlllgiGglprGelv
00482551   1/1  ------------------------------------------everlstgipalDellgGglppgslvli
00498531   1/1  ---------------------------------------ldklgkildlalkileksflklevlalgvle
00510561   1/1  ---------------------------------------ldglgepldgllpilaklfrpievlalglle
00439861   1/1  ---------------------------------------kleeveristgipeldellgGglpkgslili
00495031   1/1  --------------------------------lsalellleledltkistgipaLddvlsggipkGelvl
00361211   1/1  -----------------------------plellgepllelenlsksyggitalddvslgirkGeivllv
00397901   1/1  ----------------------------------------------------------------------
00495371   1/1  -------------------------------esalellleledltklstgikaLddvlggglpkGeivll
00500611   1/1  ----------------------------pgllsllelllelenltklptgipaLddvlgggipkGeivll
00496111   1/1  ----------------------------------------elenltklytgikaLddllslgippGeivl
00498251   1/1  -------------------------------------vekllglalllieklflkvlprllsllelenls
00469451   1/1  -------------------------------------allelenlskiyggvpkalddvslgiepGeiva
00488521   1/1  ----------------------------------------------lllllalelllevenlristgike


                         -         -         -         +         -         -         -:280
query           ARPAVGKTAFALNIAQNVATSTDTSVAIFSLEMSAESLVNRMLCAEGSINANHLRTGQLDEGEWQNLIVA
00468951   1/1  livGppGsGKTtlalqlaanla.klggkvlyidteesldqlrarrlgld.....................
00482551   1/1  aGppGsGKTtlalqlaanaalplelgklggkvlyisteeafsperlreralsl.................
00498531   1/1  rkeverlstGikaLDallgiGglprGsltliaGppGsGKTtlalqlaanla.klggkvlyisteesleql
00510561   1/1  rksverlstGikaLDlllgiGglprGelvliaGppGsGKTtlalqlaanla.aqggkvlyisteesleql
00439861   1/1  tGppGsGKTtlalqlaanlakn.ggkvlyisleesreqllera...................erlgldle
00495031   1/1  lvGpsGsGKTtlllqlagllalglgliplggkvlyigleltlsperlrlraqsl............gldl
00361211   1/1  GpsGsGKStllrnllagllaptggsvlldgleisalslaerlragigyvfqdlalfpeltvlenlalgra
00397901   1/1  ----------------------------------------------------------------------
00495371   1/1  lGpsGsGKttlalrllagllkp...evlvdgldltglsparggiglvfqteallppltvr......enle
00500611   1/1  vGpsGsGKTtlllqlagllapdsgeillggkvlyisleeslrrrrigmvfqelgldpdltv.........
00496111   1/1  lvGpsGsGKTtlalrllagllkptggkvliiglelsaeelrerr.rrigyvfqepalfpeltvlenlalg
00498251   1/1  kiytgipaldvslglgGlppGeivlllGpsGsGKTtLalrllagllkp.gggvvyidgeesldllrarrl
00469451   1/1  lvGpsGsGKstllrllagllaglptsGeillldgkdvlylsleesleqlrrrigyvfqdpalfp......
00488521   1/1  ldkllsgglppgeitlivGpsGsGKTtLllqlavngllppdsGeiggkvlyvdqeeslfpltvlenlalg


                         -         *         -         -         -         -         +:350
query           MGALSNTSIFIDDTPGIKMAEIRAKCRRLAKEKGNLGLVVIDYLQLIEGSNKESRQQEVSEISRQLKKLA
00468951   1/1  .............lddllllpaltveellalaerllsg.gkpqlvviDsltalrpalllldeptgellgl
00482551   1/1  .........gldleelldrllvidatdlldllellerlrrllse.gkvdlvviDslallaraelldepll
00498531   1/1  rarrlgld...........................ldellll....paltveellalaerllsg.gkpdl
00510561   1/1  rarrlgld.............................ldrlllldaltv..eellalaerlls.ggkvdl
00439861   1/1  ellllgllsiliadplglsgeellrvllalalel.kpdlliiDeltalld...aervrelrellralkrl
00495031   1/1  dellerllvidll..........elvgllelldrlpre.lsggqrqrvviDalalllrpellDeptsald
00361211   1/1  rellerlglail...drlpgeLSgGqqqrvaiaralal...dpdllllDeptsalssrssendpetvael
00397901   1/1  ----------------------------------------------------------------------
00495371   1/1  algldlrglldrerviellelvgleelldrlprelsggnqrqrvviaalallpkllllDEptsaldvslr
00500611   1/1  ...........arerviellelvgllelldrlprelkrsggqrqrvviDaralllrpellDEptsaldvs
00496111   1/1  ll...........drlpgeldlSgglqrqrvaia....agdpdllllDeptsalr.slgndpelraellr
00498251   1/1  ...gvvlqelllfpeltveenl.............................drlprllsggqrqrvvids
00469451   1/1  ........aeellelvgledlldrlpgelSgGqrqaiara.ard...pdllllDeptsalr.gsenDpet
00488521   1/1  ................gedveellerlgl.dlldrlphqlsggqrqrvaiaralaee.lkpdllvlDeit


                         -         -         -         -         *         -         -:420
query           KELSVPILALSQLSRGVEQRQDKRPVLSDIRESGSIEQDADIVAFLYRDDYYERGESKSEEDGDDQDSLN
00468951   1/1  dvrllsellrllkrlakelgvtvilvshvlkegedraddvp...dlagggvleqiadvviflerdeaykg
00482551   1/1  gldarelrellrlLkrlakelgvtviltsqltrevedradkrpdlsdlrgggaleqladtvlller....
00498531   1/1  vviDsltalapslllldepgrvtqgldarllreilrllkrlakelgitvlltshvtrevedraddvpvla
00510561   1/1  vviDsltalap.alelsllldeptsgldasllreilrllkrlakelgvtvllvshvlkevedladpvp..
00439861   1/1  akelgvtvilvsqlt.........elildalagggaleqladgvillkrdetakgg..............
00495031   1/1  vqlvaeilrlLkrlakelgvtvilvthdlrevegrleladrvvvlrggrileqgadvvlflrrde.....
00361211   1/1  lellkelakelgvtvilvthdldlldsallrpgkrpllsdlrgsgeieqladrvlvlergriv.......
00397901   1/1  ----------------------------------------------------------------------
00495371   1/1  aeilrlLkrlakelgvtvllvthdleeveeladrvavlag...griveqgadvvlflrrde.........
00500611   1/1  lraeilrlLkrlakelgvtvllvthdlreveeladkrdrvvvlrggriveqgadvvlflrrde.......
00496111   1/1  llkrl.kelgvtvilvthdleeae..........dladsgriavladgrivlegdlae............
00498251   1/1  alalrp..kllllDEPtsgldplsarellellrrllrlakelgvtvllvthdldeaealadrvlvl...a
00469451   1/1  raeilrlLkelakelgvtvilvtH...........................As-----------------
00488521   1/1  alfraelegrptsaldvsllrellrlLkrlakelgvtvllvthdldevarladrvlvlag...grivehg


                         -         -         +         -         -         -         -:490
query           QDVGEVELIIEKNRAGARGTVKLLFIKSYNKFSNISYAQEPPM---------------------------
00468951   1/1  ilpaig.............glrelr---------------------------------------------
00482551   1/1  ..................erggvrelii------------------------------------------
00498531   1/1  g...ggvlehladvvlflerdeaykg--------------------------------------------
00510561   1/1  .dlrgggvlehiadvvlllerdeiylkdg....-------------------------------------
00439861   1/1  .....rriliivknrggptgevplvfiitgegiedl----------------------------------
00495031   1/1  .................ggvrelivvkn------------------------------------------
00361211   1/1  ...........eegtpeeliilknrtngptgevlllfl--------------------------------
00397901   1/1  ----------------------------------------------------------------------
00495371   1/1  .............gglrelivvknrlgp------------------------------------------
00500611   1/1  ...............ggvrelivvknrl------------------------------------------
00496111   1/1  .......lglrralivlksrlgplgtvilvfeitdggivvldl---------------------------
00498251   1/1  ggrilehgadtvlllrrdel--------------------------------------------------
00469451   1/1  ----------------------------------------------------------------------
00488521   1/1  adtvllleplggyt..............------------------------------------------