[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for noce0:ABA56702.1


[Show Plain Result]

## Summary of Sequence Search
   1::214
  70::192  PF00156 0.0% 31.404958677686  Phosphoribosyl transferase domain 
   1::214


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MARLARTFCDGHHKSQGVRFICLFNPNHIKCLPQILVYLGKASMERLKTKIRDIPDFPKPGVLFKDITPL
PF00156         ---------------------------------------------------------------------l


                         -         -         *         -         -         -         -:140
query           VGDPATLRLAVHQLLHPFLEQDITAVGGIEARGFIFGALVAWELGVGFIPLRKSGKLPYEVRSISYQLEY
PF00156         lldpedlreagrllaeklreekgkkdvvvGiargGvplatelaraLglpldlvrvrkssap..assetsr


                         +         -         -         -         -         *         -:210
query           GSASLEAHTDSLGPGDNVLLVDDLLATGGTAKASCELVESLGATVAACAFVIELDFLHGRERLSDYTVHS
PF00156         kreaailesrpeedlkgkrvliVDDvlatGgTlraaielLkeagakevgvav------------------


                         -         -         -         +         -         -         -:280
query           LVHY------------------------------------------------------------------
PF00156         ----------------------------------------------------------------------