[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for noce0:ABA56724.1


[Show Plain Result]

## Summary of Sequence Search
   1::270
  10::118  PF00581 0.0% 33.6538461538462  Rhodanese-like domain 
 153::262  PF00581 0.0% 36.6336633663366  Rhodanese-like domain 
   1::270


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MAMFSLLLQPDELVRRLDEKNLLLIDLGSEESYLARHVPGAVHLDYTHIVAARPPVMGLLPDEHRLSRVL
PF00581         ---------akelkellekekvvllDvRspeeyekghIpgAvnvpldsl.....ypkrdlpfkdklaeel
PF00581         ---------akelkellekekvvllDvRspeeyekghIpgAvnvpldsl.....ypkrdlpfkdklaeel


                         -         -         *         -         -         -         -:140
query           SQLGFTPESHVVAYDAEGNGRASRLLWTLEELGHKHFSLLDGGLKAWLVEECPVKEGRESRQPSHFHGRY
PF00581         eesgkkldkkktvvvycssgnrsggaaalllalilkelgyknvyvLdG----------------------
PF00581         eesgkkldkkktvvvycssgnrsggaaalllalilkelgyknvyvLdG----------------------


                         +         -         -         -         -         *         -:210
query           QGHQAADKEYILAHLLDPKVVILDARSPAEYHGEYVRAQRGGHIPGAVNFEWTQAIDQERNLRFKPMDEL
PF00581         ------------kellekekvvllDvRspeey........ekghIpgAvnvpldsl.ypkrdlpfkdkla
PF00581         ------------kellekekvvllDvRspeey........ekghIpgAvnvpldsl.ypkrdlpfkdkla


                         -         -         -         +         -         -         -:280
query           RSSLEALGITPDKEVICYCQTHHRSAHTCMVLKYLGYPKIKGYPGSWSEWGNAPDTPIKV----------
PF00581         eeleesgkkldkkktvvvycssgnrsggaaalllalilkelgyknvyvLdGG------------------
PF00581         eeleesgkkldkkktvvvycssgnrsggaaalllalilkelgyknvyvLdGG------------------