[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for noce0:ABA56789.1


[Show Plain Result]

## Summary of Sequence Search
   1::307
 101::287  PF08443 0.0% 31.4917127071823  RimK-like ATP-grasp domain 
 135::254  PF02955 0.0% 26.7241379310345  Prokaryotic glutathione synthetase, ATP-grasp domai 
 102::266  PF02655 0.0% 23.2876712328767  ATP-grasp domain 
   1::307


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MLRIVIFNNSHGWHSKQLEAALAPQGVAIIRSNLAQCRIDLDSPSGLHIPGLGGDLPDAAIVRGIAAGSF
PF08443         ----------------------------------------------------------------------
PF02955         ----------------------------------------------------------------------
PF02655         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           EQITLRLDVLHTLAEFGIPVLNTASAIERTVDKARTSLLLRHRRVPTPRAWACEDLAQARHLSAQAQREK
PF08443         ------------------------------rdKlkslklLakkkikvpktalarseedaekliekik..q
PF02955         ----------------------------------------------------------------afleek
PF02655         -------------------------------dKlktykaLkeagvkvP..........skleaeeleeee


                         +         -         -         -         -         *         -:210
query           RELVLKPLFGCQGQGIIRIGKPADLEACEPTGGLYYLQEFIRPAQPNIWQDWRVFVIGHRPIAAMVRRGQ
PF08443         fPvvvKsvfgsqGikvvlaedkqsleqlleafkqlkeailvQefIeeaen...rdiRvlVvgdevvaale
PF02955         gdvilKPLdgkgGkgvfrvkkedanlksilellteegeepviaqkyl....peikeGDkRilllnGepig
PF02655         kklvvKprdGaGgesvrvvenkeeaeealeele..vvqefieGeplSvsvlsdgekvlllavnrqliele


                         -         -         -         +         -         -         -:280
query           GWITNVARGAQYFPAPLEREIGALACQATQAVAVDYGGVDIIQTPAQGFQVLEVNSIPSWKALQQTTEVN
PF08443         rvskeGdfrsNlarGgvaeklqlseeeeelaikaaeameldvlgvDilesk.rgllvlEvNssvglkkie
PF02955         alaRipaegevRsNlaaggraeatelterdreiaeelgpkLkek--------------------------
PF02655         ekk......fvyaGnltpietelkeelvelaeevvealegllGyvGvDlvlkd.ee--------------


                         -         *         -         -         -         -         +:350
query           IAGALAKNLLERLHSSYFAHSGSSQKI-------------------------------------------
PF08443         ktlgini---------------------------------------------------------------
PF02955         ----------------------------------------------------------------------
PF02655         ----------------------------------------------------------------------