[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for noce0:ABA56844.1


[Show Plain Result]

## Summary of Sequence Search
   1::276
   5::125  PF01678 0.0% 40.3361344537815  Diaminopimelate epimerase 
 154::269  PF01678 0.0% 33.9130434782609  Diaminopimelate epimerase 
   4::227  PF02567 0.0% 21.2962962962963  Phenazine biosynthesis-like protein 
   1::276


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MRIAFTKMQGLGNDFVVIDALSQPLSLTASQVRWIANRRLGIGCDQVLLVTPASLPAIDFGYRIFNADGG
PF01678         ----fakshGnpndvvvvddveeelllepelvpalcdreagpgadnvlfve..asgeediklrvfnrdgs
PF01678         ----fakshGnpndvvvvddveeelllepelvpalcdreagpgadnvlfve..asgeediklrvfnrdgs
PF02567         ---aFtekpfkGNpaaVvldad...elddeemqkiAae...fnlSETaFvlppsdekarfrlRiFTpv.a


                         -         -         *         -         -         -         -:140
query           EVEQCGNGARCFARFVREQGLTDKNVLRVQTASGIIELQLETDGQITVDMGVPRFAPHQIPFKVDQEADY
PF01678         eteaCGnGvrvfaaalregglvtkkevrvetlgGeleievkddgekvkvmmGkav---------------
PF01678         eteaCGnGvrvfaaalregglvtkkevrvetlgGeleievkddgekvkvmmGkav---------------
PF02567         EvplcGHatlatahvLfeeglvenktleletkaGilpvkslkekdkgeelavelnfPefdleevssedta


                         +         -         -         -         -         *         -:210
query           YSLELDGQQVEIGAVSMGNPHCVLRVPAVDTAPVAHWGPLLESHPRFPQRVNVGFAQIVSPGHLRLRVYE
PF01678         -------------akshGnpndvvvvddveeelllepelvpalcdreagpgadnvlfveasgeediklrv
PF01678         -------------akshGnpndvvvvddveeelllepelvpalcdreagpgadnvlfveasgeediklrv
PF02567         allellasefiealpiavkstglekvvvplkskealealkpdls.daikkcpkngvivtaaasagskrdf


                         -         -         -         +         -         -         -:280
query           RGAGETPACGTGACAAAVIGKRRGWLSGQVNVDLPGGRLGIHWEGDGKSVWMSGPAEIVFKGSIEL----
PF01678         fnrdgseteaCGnG.vrvfaaalregglvtkkevrvetlgGeleievkddgekvkvmmG-----------
PF01678         fnrdgseteaCGnG.vrvfaaalregglvtkkevrvetlgGeleievkddgekvkvmmG-----------
PF02567         asRmFaPklGivEDpvt-----------------------------------------------------