[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for noce0:ABA56902.1


[Show Plain Result]

## Summary of Sequence Search
   1::696
  20::49   PF00563 0.0% 26.6666666666667  EAL domain 
 449::684  PF00563 0.0% 35.7758620689655  EAL domain 
 272::427  PF00990 0.0% 29.4871794871795  GGDEF domain 
  10::114  PF00072 0.0% 23.3009708737864  Response regulator receiver domain 
 147::221  PF00989 0.0% 31.0810810810811  PAS fold 
 433::468  PF00989 0.0% 16.6666666666667  PAS fold 
 167::232  PF08447 0.0% 29.6875  PAS fold 
   1::696


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MLSSKNIVRLLIVDASFEDAEMVTNLLRKMGFAARASRVEKEEEFREAIEGQSWDIIVCAAMLPQFSVAR
PF00563         -------------------lkalialarelgikviaegVeteeqlellk---------------------
PF00563         -------------------lkalialarelgikviaegVeteeqlellk---------------------
PF00990         ----------------------------------------------------------------------
PF00072         ---------vlivdDeplvrellrqalekegy.eevaeaddgeealellkekdpDlillDiempgmdGle
PF00989         ----------------------------------------------------------------------
PF00989         ----------------------------------------------------------------------
PF08447         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           AAQILLQSEKDISLIIVVDEKTDSDDIDEMYVAGVRDVVLKSRPLRLQSVIKRELQDLENRRARRHSEMV
PF00563         ----------------------------------------------------------------------
PF00563         ----------------------------------------------------------------------
PF00990         ----------------------------------------------------------------------
PF00072         llkeireeepklpiivvt.ahgeeedalealkaGakdflsKpfd--------------------------
PF00989         ----------------------------------------------------------------------
PF00989         ----------------------------------------------------------------------
PF08447         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           LGESERQVRALLESSRDAVGYVHEGMHIYANRAYLELFGYHELDEIEGMPLLDMIAPEEHNRFKAFLKEY
PF00563         ----------------------------------------------------------------------
PF00563         ----------------------------------------------------------------------
PF00990         ----------------------------------------------------------------------
PF00072         ----------------------------------------------------------------------
PF00989         ------dlraileslpdpifvvDedgrilyvNaaaeellGlsr.eevlgkslldliheeddaelaelleq
PF00989         ------dlraileslpdpifvvDedgrilyvNaaaeellGlsr.eevlgkslldliheeddaelaelleq
PF08447         --------------------------iiyvsprveeilGysp.eel.gkssyedwldlvhpeDrervrea


                         -         -         -         +         -         -         -:280
query           GASEGKSAHFTLRAHKADGHTFTAAWEFTPASIEGEFCTQIVIRDKTYDLAAEERIKQVQQRDILTGFFS
PF00563         ----------------------------------------------------------------------
PF00563         ----------------------------------------------------------------------
PF00990         -------------------------------------------------------------hDplTgLpN
PF00072         ----------------------------------------------------------------------
PF00989         lleqgeesrag-----------------------------------------------------------
PF00989         lleqgeesrag-----------------------------------------------------------
PF08447         leelllkkgevysfeyRirrkd------------------------------------------------


                         -         *         -         -         -         -         +:350
query           RPHYLELMEKWVIAARAGDRESSLLYIAIDQFNRVRARVGIGASDLVVVDVARILQQYCDEKVILARFGD
PF00563         ----------------------------------------------------------------------
PF00563         ----------------------------------------------------------------------
PF00990         RrlleeeleqelqraareqkslalllldldnFkeindtyGhaaGDevLqevaqrLssslrrsdlvaRlgg
PF00072         ----------------------------------------------------------------------
PF00989         ----------------------------------------------------------------------
PF00989         ----------------------------------------------------------------------
PF08447         ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           EVFTLLLPHGSDEQEDALAEQLRQAVDRHLVEMDERSINVTCSIGICRIGESAPGGQQILERAHKACLKA
PF00563         ----------------------------------------------------------------------
PF00563         ----------------------------------------------------------------------
PF00990         deFiillpetsseeaqelaerierllaelkepveasgeelyvtisiGiaavkpeegedleellkeADeal
PF00072         ----------------------------------------------------------------------
PF00989         ----------------------------------------------------------------------
PF00989         ----------------------------------------------------------------------
PF08447         ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           QEAGGNRIERYRPVIEDLTDQEKIKQWEVQLREAMNNKDGFCLFYQPIVSLHGETEEIFEVLLRMTDDAG
PF00563         ----------------------------qalrealenk.elslvfQPivdlstgkvvgyEallrwkhpeg
PF00563         ----------------------------qalrealenk.elslvfQPivdlstgkvvgyEallrwkhpeg
PF00990         yeaKkag---------------------------------------------------------------
PF00072         ----------------------------------------------------------------------
PF00989         ------------l......rdgrpihlevraspvrdaggeilgflgvl----------------------
PF00989         ------------l......rdgrpihlevraspvrdaggeilgflgvl----------------------
PF08447         ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:560
query           GYILPEKFLEPAAQLKLMGEIDRWVIAKAMSVLHSRHQVGQLIRFFVKLSDPSIHDKNLLPWLKKHLQES
PF00563         gvispeeflplaerlgliaeldrlllekalaqlaelakkasldpdlklsvnlspasllsdefleqllell
PF00563         gvispeeflplaerlgliaeldrlllekalaqlaelakkasldpdlklsvnlspasllsdefleqllell
PF00990         ----------------------------------------------------------------------
PF00072         ----------------------------------------------------------------------
PF00989         ----------------------------------------------------------------------
PF00989         ----------------------------------------------------------------------
PF08447         ----------------------------------------------------------------------


                         -         -         -         *         -         -         -:630
query           GLDARSLIFEISESSALNYLKRVQQLVEGLRVLGCQFALEHVGTGLDTSNCLKHINVDYLKIDGAFIENL
PF00563         .eaglparrlvlEisesdl.deslellealarLrslGirlalddfgtgysslsrlaelppdviKidrsll
PF00563         .eaglparrlvlEisesdl.deslellealarLrslGirlalddfgtgysslsrlaelppdviKidrsll
PF00990         ----------------------------------------------------------------------
PF00072         ----------------------------------------------------------------------
PF00989         ----------------------------------------------------------------------
PF00989         ----------------------------------------------------------------------
PF08447         ----------------------------------------------------------------------


                         -         +         -         -         -         -         *:700
query           LQDEQNQEAVKIIIEMAKEAGKPTIAEFVSDANTLALLWQFGLDYAQGRYIQEPNQFLSYEFSGGI----
PF00563         kdls.dpearallkalialarelgikviaegVeteeqlellkelgidlvQGylf----------------
PF00563         kdls.dpearallkalialarelgikviaegVeteeqlellkelgidlvQGylf----------------
PF00990         ----------------------------------------------------------------------
PF00072         ----------------------------------------------------------------------
PF00989         ----------------------------------------------------------------------
PF00989         ----------------------------------------------------------------------
PF08447         ----------------------------------------------------------------------