[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for noce0:ABA56917.1


[Show Plain Result]

## Summary of Sequence Search
   1::454
   3::450  PF00171 0.0% 40.0447427293065  Aldehyde dehydrogenase family 
 102::289  PF05893 0.0% 22.4043715846995  Acyl-CoA reductase (LuxC) 
   1::454


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MAFESVNPATGQSLKTFDAWDQNAIDGVLQQVQEASPLWAARDLSERCRLLRAAAQQLRERKEDLARLIT
PF00171         --ievinPatgeviakvaaataedvdaavaaAkaafkawaklpaeeRaeilrkaadlleerrdelaelev
PF05893         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           LEMGKLLGEARAEIEKCAWVCEYYEEHAPRFLADEVIESDARRSYVALQPLGTVLAIMPWNFPFWQVFRF
PF00171         letGkplaearaevaeaidvlryyagaaek.legevlpssegkkalvrrePlGvvaaitPWNfPlllaaw
PF05893         -------------------------------iLdeflprkd..syekaqpkglvvhvlagNvpllpvmsi


                         +         -         -         -         -         *         -:210
query           CAPALVAGNTAVLKHAANVPQCGLAIEQTLLEAGFPPGVFRTLLVSSSQTAKVIADPRVQGVTLTGSEAA
PF00171         klapalaaGNtvvlKpseetpltalllaelleeaglPkgvlnvvtgsgsevgealvehpdvdkvsftGst
PF05893         .lqglLvknvnllkvSssdpflaaallksladvdadhtlarsisvvywkssdtkleeeivqnaDvviawG


                         -         -         -         +         -         -         -:280
query           GRKVAECAGRHLKKTVLELGGADPFIVLADADLEQAVPVAVQSRFINGGQSCIAAKRFIVMEEIADEFIA
PF00171         evgrkiakaaaknlkkvtlElGGkspliVledaDldkaveaivkgaflnaGQvCiatsrllVhesiydef
PF05893         Geeaikaiskklkpg..vklikfGpkiSlavvdkeaalekaaeavAkDicvydQqAClspqvvfvekdde


                         -         *         -         -         -         -         +:350
query           RFQADLEALQPGDPLDEQTTLAPLARLDLRAGLHQQVTASIQQGAVAVAGCQPLPGTGTYYAPSILDRVQ
PF00171         veklveaakklkvGdpldedtdlGPliskkqlervekyieeakeegaklllGGeeekaglekgyfvePtv
PF05893         aeldefaek-------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           PGMPAFDEELFGPVAAIIRVANEAEAVAMANASRYGLGGSVWSQNTSRAERLALELRCGAAFVNGLVKSD
PF00171         ladvtpdmriaqeEiFGPVlsvikfkdeeeaielaNdteyGLaaavftedleraervaerleaGnvwiNd
PF05893         ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           PRLPFGGIKCSGYGRELSWHGMREFTNQKTLWIK------------------------------------
PF00171         sstgdaealpfgGvkqSglGreggkeglee----------------------------------------
PF05893         ----------------------------------------------------------------------